SecReT6
Effector Protein ID: 116049604
hcpD
SecReT6 ID152
T6SS typeA1
Gene symbolhcpD
Locus tagPA14_43070
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]3831886..3832404 [+]
Productsecreted protein Hcp
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDQ02E95
KEGG IDpau:PA14_03240, pau:PA14_69560, pau:PA14_44890, pau:PA14_43070
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-41, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|116049604|ref|YP_791591.1| hcpD gene product [Pseudomonas aeruginosa UCBPP-PA14]
MATPAYMSITGTKQGLITAGAFTEDSVGNTYQEGHEDQVMVQGFNHEVIIPRDPQSGQPTGQRVHKPVVI
TKVFDKASPLLLAALTSGERLTKVEIQWYRTSAAGTQEHYYTTVLEDAIIVDIKDYMHNCQDPGNAHFTH
LEDVHFTYRKITWTHEVSGTSGSDDWRSPVAG
-
Nucleotide Sequence: 519 bp     [Download]
>gi|116048575|ref|NC_008463.1|:3831886-3832404 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGGCAACCCCCGCCTATATGTCCATCACCGGCACCAAGCAGGGCCTGATCACCGCCGGCGCCTTCACCG
AGGATTCGGTCGGCAACACCTACCAGGAAGGCCACGAGGACCAAGTGATGGTCCAGGGCTTCAACCACGA
AGTGATCATCCCGCGCGATCCGCAGTCCGGCCAGCCGACCGGTCAGCGCGTGCACAAGCCGGTGGTCATC
ACCAAGGTCTTCGACAAGGCCTCGCCGCTGCTGCTGGCCGCCCTGACCTCCGGCGAGCGCCTGACCAAGG
TCGAGATCCAGTGGTACCGCACCTCCGCCGCCGGCACCCAGGAGCACTACTACACCACCGTCCTGGAAGA
CGCGATCATCGTCGACATCAAGGACTACATGCATAACTGCCAGGACCCGGGCAACGCCCACTTCACCCAC
CTGGAAGACGTGCACTTCACCTACCGCAAGATCACCTGGACCCACGAAGTCTCCGGCACCTCCGGCTCCG
ACGACTGGCGCTCCCCGGTCGCCGGCTGA