SecReT6
Effector Protein ID: 116049796
SecReT6 ID150
T6SS typeA3
Gene symbol-
Locus tagPA14_40660
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]3630345..3630809 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA1844
DescriptionTse1
UniProt IDQ02KY9
KEGG IDpau:PA14_40660
PDB IDNA
Domain hit(s) vs Pfam CHAP [PF05257], Evalue: 0.00025, Aligned region: 29..97
CHAP [PF05257], Evalue: 0.00025, Aligned region: 103..130
NLPC_P60 [PF00877], Evalue: 0.0012, Aligned region: 23..98
NLPC_P60 [PF00877], Evalue: 0.0012, Aligned region: 134..153
Protein Sequence: 154 a.a.     [Download]
>gi|116049796|ref|YP_791397.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MDSLDQCIVNACKNSWDKSYLAGTPNKDNCSGFVQSVAAELGVPMPRGNANAMVDGLEQSWTKLASGAEA
AQKAAQGFLVIAGLKGRTYGHVAVVISGPLYRQKYPMCWCGSIAGAVGQSQGLKSVGQVWNRTDRDRLNY
YVYSLASCSLPRAS
-
Nucleotide Sequence: 465 bp     [Download]
>gi|116048575|ref|NC_008463.1|:3630345-3630809 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGGACAGTCTCGATCAATGCATCGTCAACGCCTGCAAGAACAGCTGGGACAAGAGCTACCTGGCCGGCA
CCCCGAACAAGGACAACTGTTCCGGCTTCGTCCAGTCGGTGGCCGCCGAGCTGGGCGTACCGATGCCCCG
CGGCAACGCCAACGCCATGGTCGACGGCCTGGAGCAGAGCTGGACCAAGCTCGCCTCCGGCGCCGAGGCC
GCGCAGAAGGCGGCCCAGGGCTTCCTGGTGATCGCCGGCCTGAAGGGCCGCACCTACGGGCACGTCGCGG
TGGTCATCAGCGGTCCGCTGTATCGGCAGAAGTACCCGATGTGCTGGTGCGGCAGCATCGCCGGCGCGGT
CGGCCAGAGCCAGGGCCTGAAGTCGGTCGGCCAGGTGTGGAATCGCACCGACCGCGACCGCCTCAACTAC
TACGTCTACTCCCTGGCCAGTTGCAGCCTGCCCAGGGCCAGTTGA