SecReT6
Effector Protein ID: 116050774
SecReT6 ID150
T6SS typeA3
Gene symbol-
Locus tagPA14_28210
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]2441454..2442041 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2774
DescriptionTse4
UniProt IDQ02NT1
KEGG IDpau:PA14_28210
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 195 a.a.     [Download]
>gi|116050774|ref|YP_790405.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MSQLPIPLPLNESRWRYVTASGGGVTVAFLAGSGGSITLLSPEGENVSFRYGGVGGGIGLGMRLPRFGKV
NLNVKGKSVGGAGALEALPSTGTVLVADGLVGRDLSRGDFTGPCMYVELGAGVIAGGSGTAILFGLDPKL
LAAVALASASPLTAALGASMSRQLLQSSRGALLMAGVNVGAQFGGGAAAYLGALF
-
Nucleotide Sequence: 588 bp     [Download]
>gi|116048575|ref|NC_008463.1|:2441454-2442041 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGTCGCAACTTCCCATTCCCTTGCCCCTCAACGAGAGTCGCTGGCGCTATGTGACGGCCAGCGGCGGAG
GTGTGACCGTGGCCTTCCTGGCGGGCAGCGGCGGCTCCATCACGTTGCTCTCGCCGGAGGGTGAGAACGT
GTCCTTCCGCTATGGCGGGGTGGGCGGCGGGATCGGACTGGGCATGCGCCTGCCGCGCTTCGGCAAGGTC
AACCTCAATGTCAAGGGCAAGAGCGTTGGCGGGGCCGGTGCGCTGGAGGCGTTGCCGAGCACCGGAACCG
TCTTGGTCGCGGACGGCCTGGTGGGGCGCGACCTGTCCCGCGGCGACTTCACCGGGCCCTGCATGTACGT
CGAACTCGGCGCGGGAGTCATCGCCGGCGGTTCGGGCACGGCGATCCTCTTCGGCCTCGATCCCAAGCTG
CTGGCGGCGGTGGCGCTGGCGAGCGCCTCGCCATTGACCGCCGCGCTGGGCGCCAGCATGTCGCGGCAAT
TGCTGCAATCGTCCCGTGGCGCCCTGTTGATGGCCGGGGTCAACGTCGGTGCACAGTTCGGCGGCGGCGC
GGCGGCTTACCTGGGGGCGTTGTTCTGA