SecReT6
Effector Protein ID: 116051502
SecReT6 ID150
T6SS typeA3
Gene symbol-
Locus tagPA14_19020
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]1642132..1643358 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA3484
DescriptionTse3
UniProt IDQ02QX3
KEGG IDpau:PA14_19020
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 408 a.a.     [Download]
>gi|116051502|ref|YP_789663.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MTATSDLIESLISYSWDDWQVTRQEARRVIAAIRNDNVPDATIAALDKSGSLIKLFQRVGPPELARSLIA
SIAGRTTMQRYQARNALIRSLINNPLGTQTDNWIYFPTITFFDICADLADAAGRLGFAAAGATGVASQAI
QGPFSGVGATGVNPADLPSIAFGDQLKLLNKDPATVTKYSNPLGDLGAYLSQLSPQDKLNQAQTLVGQPI
STLFPDAYPGNPPSRAKVMSAAARKYDLTPQLIGAIILAEQRDQTRDEDAKDYQAAVSIKSANTSIGLGQ
VVVSTAIKYELFTDLLGQPVRRGLSRKAVATLLASDEFNIFATARYIRYVANLASQQDLRKLPKTRGAFP
SIDLRAYAGNPRNWPRDNVRALASEYTSRPWDDNLSPGWPMFVDDAYATFLDPGMRFP
-
Nucleotide Sequence: 1227 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c1643358-1642132 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGACCGCCACCAGCGACCTGATCGAGTCACTGATTTCCTATAGCTGGGACGACTGGCAGGTGACCCGCC
AGGAAGCCCGCCGGGTGATCGCCGCGATCCGCAACGACAACGTGCCCGATGCGACCATCGCCGCACTCGA
CAAGAGCGGCTCGCTGATCAAGCTGTTCCAGCGGGTGGGCCCGCCGGAACTGGCGCGCTCGCTGATCGCC
AGCATCGCCGGGCGCACCACCATGCAGCGCTACCAGGCACGCAATGCCTTGATCCGCAGCCTGATCAACA
ATCCCCTGGGCACCCAGACCGACAACTGGATCTACTTCCCCACCATCACCTTCTTCGACATCTGCGCCGA
CCTCGCCGACGCCGCTGGCCGCCTGGGCTTCGCCGCGGCCGGCGCCACCGGGGTGGCCAGCCAGGCGATC
CAGGGTCCGTTCAGCGGGGTCGGCGCCACCGGCGTCAATCCGGCCGACCTGCCGTCCATTGCCTTCGGCG
ACCAGCTCAAGCTGCTCAACAAGGACCCGGCGACCGTCACCAAGTACAGCAACCCGCTCGGCGACCTGGG
CGCCTACCTGAGCCAGCTTTCGCCGCAAGACAAGCTGAACCAGGCACAGACGCTGGTCGGCCAGCCGATC
AGCACGCTGTTCCCCGACGCCTATCCGGGCAACCCGCCGTCGCGGGCCAAGGTCATGTCCGCGGCTGCGC
GCAAGTACGACCTGACGCCGCAACTGATCGGCGCGATCATCCTCGCCGAGCAGCGTGACCAGACCCGCGA
CGAAGACGCCAAGGACTATCAGGCGGCAGTCAGCATCAAGAGCGCCAACACCTCCATCGGCCTCGGCCAG
GTGGTGGTCTCCACCGCGATCAAGTACGAGCTGTTCACCGACCTGCTCGGCCAGCCGGTGCGCCGCGGCC
TGTCGCGCAAGGCGGTCGCCACCCTGCTGGCTTCCGACGAATTCAACATCTTCGCCACCGCCCGTTACAT
CCGCTACGTCGCCAACCTGGCGTCGCAACAGGACCTGCGCAAGTTGCCGAAGACCCGCGGTGCATTTCCC
TCCATCGATCTCCGCGCCTACGCCGGCAATCCGCGCAACTGGCCGCGGGACAATGTCCGCGCGCTGGCCT
CGGAATACACCTCGCGTCCCTGGGACGACAACCTGTCGCCGGGCTGGCCGATGTTCGTCGACGATGCCTA
CGCCACCTTCCTCGACCCTGGAATGAGGTTCCCATGA