SecReT6
Effector Protein ID: 116051504
pldA
SecReT6 ID152
T6SS typeA1
Gene symbolpldA
Locus tagPA14_18970
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]1635662..1638973 [-]
Productphospholipase D
Effector typeProtein
Homologous effectorPA3487
DescriptionPldA
UniProt IDQ02QX6
KEGG IDpau:PA14_18970
PDB IDNA
Domain hit(s) vs Pfam PLDc [PF00614], Evalue: 1.90E-17, Aligned region: 168..193
PLDc [PF00614], Evalue: 1.90E-17, Aligned region: 856..881
PLDc_2 [PF13091], Evalue: 5.80E-09, Aligned region: 159..187
PLDc_2 [PF13091], Evalue: 5.80E-09, Aligned region: 812..898
Protein Sequence: 1103 a.a.     [Download]
>gi|116051504|ref|YP_789660.1| pldA gene product [Pseudomonas aeruginosa UCBPP-PA14]
MLQKKPYNGLHEKELNQINQQDGSPCVAISAPGCFIKGSNLFSEKRAGNRVRFFTTGRDYFSDLASALDS
ALDSASSSIFITGWQVNYDVLLDGRRSLWQCLRQALERSPALKVYVMPWLSPSGSLGTYDFETMLAVFQL
NAGLEGGARAFCTPAIQQSDMQGLGVAFSHHQKSVVIDNRIGYVGGIDLAYGRRDDNDFSLDASGRRGND
AYNPGLPHLGWMAEDEHVSSMGLMMATLFDLSRPLASLTLHAPTLRLSPFPHIAASDEPLLSIPLAPSRA
RALNGAAYLSDLFRSPMLPSLQWLGRAYNSSKEGLDEGFERLDALRRQMVASSIRAIANLIADNLDALPI
EPELERRLRAWLEELRTAALNLPEALRIKSLLLINQWMSETELGQVLTLISGKGFEDIPQNLSGKAGELA
GSLFWTLHRLLQARAGGHQQPYRYLDEAPQPLASPDNARLAADQPRMPWQDVHCRIEGPSVYDLARNFID
RWNGQQAYLAKTPALQDTALVRSALEAVMKWLNSLAAAAGLENYLDEKRNLRLELDPPTPCWINAPEQLP
QEPEVRRGGMTVQVLRSAAARMLEQEQAGRLGAGVNLPLQVGVSTEGVQSNCKDAMLLAISGAQQFIYIE
NQFFQSEFGKEGEVFKDLPLSGPMASLRDVGSLRRDFVVRIRLEEALEQRDLWLLDWAEVEKIAQEPGTE
ARQFLKSMLAMWGVNAQGWLTHKLGEAQHGLLNEIGEALARRIERAIQREHPFHVYLVLPVHPEGALNVP
NIMHQVHLTQQSLVFGEQSLVKRIQRQMALKALEGKSDPAQAREIIERKDARGRPVYEQQDWSRYLTLLN
LRTWAVLGGRVVTEQIYVHSKLLIADDRVAILGSANINDRSLQGERDSELAVMVRDSEPLTVRLDGKNDA
IVGKAIHQLRVNLWKKHFGLSQGPGGFVKPASELSAYLSIPAAQEAWEAIQTLAKENTRAYERTFNFIPQ
NISQTQLQLTPEPPKGFEDGFPASIWPTWAYRKPGELRAGGQLMEPMPYQEIFWRSSNLTSVKTFPPPNG
VSGFITALPTSWTRGERNDSGLNLSILAHQDSRSLPTQVAMNGDSSAQGKHRT
-
Nucleotide Sequence: 3312 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c1638973-1635662 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGTTGCAGAAGAAGCCCTACAACGGCCTCCACGAAAAGGAACTCAACCAGATCAACCAGCAGGATGGCA
GCCCCTGCGTAGCCATTTCCGCACCGGGCTGTTTCATCAAGGGGTCCAACCTCTTTTCCGAAAAGCGGGC
CGGTAACCGGGTCCGCTTCTTCACCACCGGCCGGGACTACTTCAGCGACCTGGCCAGCGCCCTCGACAGC
GCCCTCGACAGCGCCAGTTCGAGCATCTTCATCACCGGCTGGCAGGTCAACTACGACGTCCTCCTCGACG
GCCGCCGCAGCCTCTGGCAGTGCCTGCGCCAGGCGCTGGAGCGCTCGCCCGCGCTGAAGGTCTACGTGAT
GCCCTGGCTCAGCCCTTCCGGCAGCCTCGGCACCTATGACTTCGAAACCATGCTCGCGGTGTTCCAGCTC
AACGCCGGACTCGAGGGCGGCGCGCGCGCCTTCTGTACGCCGGCGATCCAGCAGAGCGACATGCAGGGAC
TGGGCGTCGCCTTCTCCCACCACCAGAAATCCGTGGTGATCGACAACCGCATCGGCTATGTCGGCGGGAT
CGACCTTGCCTATGGCCGTCGCGACGACAACGATTTCAGCCTCGACGCCTCCGGGCGCCGGGGCAACGAC
GCCTATAATCCCGGCCTACCGCATCTTGGCTGGATGGCGGAGGACGAACACGTCAGCTCCATGGGCCTGA
TGATGGCCACCCTGTTCGACCTTTCCAGGCCGCTCGCCAGCCTGACGCTGCATGCGCCCACCCTTCGCCT
GTCGCCCTTCCCGCACATCGCCGCCAGCGACGAACCGCTGCTGAGCATTCCCCTCGCACCCAGCCGCGCC
CGCGCCCTCAACGGCGCCGCCTACCTTTCCGACCTGTTCCGCAGCCCGATGCTGCCCTCCCTGCAATGGC
TCGGCCGCGCCTACAACAGCTCGAAAGAAGGCCTGGACGAAGGCTTCGAACGGCTCGATGCGCTCAGGCG
GCAGATGGTCGCCAGCAGCATCCGCGCCATTGCCAACCTGATCGCCGACAACCTCGACGCCCTGCCCATC
GAGCCTGAACTCGAACGCCGCCTGCGCGCCTGGCTGGAGGAACTGCGCACGGCCGCGCTCAACCTGCCGG
AAGCCCTGCGGATCAAGAGCCTGCTCCTGATCAACCAGTGGATGAGCGAAACCGAACTGGGCCAGGTCCT
GACCCTGATCAGCGGCAAGGGCTTCGAAGATATCCCGCAGAACCTGAGCGGCAAGGCCGGCGAGTTGGCC
GGCTCGCTGTTCTGGACACTCCACAGGCTGTTGCAGGCCCGCGCCGGAGGCCACCAGCAACCCTATCGCT
ACCTGGACGAAGCGCCTCAGCCATTGGCCTCGCCGGACAACGCCCGGCTGGCCGCCGACCAGCCGCGCAT
GCCCTGGCAGGATGTGCATTGCCGCATCGAAGGGCCGTCGGTGTACGACCTGGCGCGCAACTTCATCGAC
CGCTGGAACGGCCAGCAGGCCTACCTGGCCAAGACGCCGGCGCTACAGGATACGGCGCTGGTACGCAGCG
CCCTGGAAGCCGTGATGAAGTGGCTGAACAGCCTGGCCGCCGCCGCGGGATTGGAGAACTACCTGGACGA
GAAGCGCAACCTCCGGCTCGAACTGGACCCACCCACGCCCTGCTGGATCAACGCGCCGGAACAGTTGCCG
CAAGAGCCGGAGGTGCGCCGCGGCGGCATGACCGTACAGGTACTGCGCAGCGCCGCGGCGCGCATGCTCG
AACAGGAGCAGGCCGGCCGCCTCGGCGCGGGAGTGAACCTGCCCTTGCAGGTCGGCGTCTCCACCGAAGG
AGTCCAGAGCAACTGCAAGGACGCCATGCTCCTGGCGATTTCCGGGGCGCAGCAGTTCATCTATATCGAG
AACCAGTTCTTCCAGAGCGAGTTCGGCAAGGAAGGCGAAGTTTTCAAGGATCTGCCCCTTTCAGGCCCCA
TGGCCAGTCTGCGCGACGTTGGCAGCCTGCGACGCGACTTCGTCGTCCGGATACGCTTGGAGGAAGCCCT
GGAGCAGCGCGACCTCTGGCTGCTGGACTGGGCCGAAGTGGAGAAGATCGCCCAGGAGCCTGGCACCGAG
GCCCGCCAGTTCCTCAAGTCGATGCTCGCCATGTGGGGCGTGAACGCCCAGGGCTGGCTCACCCACAAGC
TCGGCGAGGCCCAGCACGGCCTGCTCAACGAGATCGGCGAAGCCCTGGCGCGGCGCATCGAACGGGCCAT
CCAGCGCGAGCACCCGTTCCACGTCTACCTGGTCCTGCCGGTGCACCCGGAGGGCGCGCTGAACGTGCCG
AACATCATGCACCAGGTGCACCTGACCCAGCAGAGCCTGGTGTTCGGCGAACAGAGCCTGGTCAAGCGCA
TTCAGCGGCAGATGGCGCTCAAGGCCCTGGAAGGCAAGTCCGACCCGGCCCAGGCCCGGGAAATCATCGA
GCGCAAGGACGCTCGCGGTCGCCCGGTCTACGAACAGCAGGACTGGAGCCGCTACCTGACCCTGCTCAAC
CTGCGCACCTGGGCGGTGCTCGGCGGGCGGGTGGTCACCGAACAGATCTACGTGCACAGCAAGCTGCTGA
TCGCCGACGACCGGGTGGCCATCCTCGGCAGCGCCAATATCAACGACCGCAGCCTGCAAGGCGAGCGCGA
CTCCGAGCTGGCGGTGATGGTGCGCGACAGCGAGCCGCTGACGGTCAGGCTGGACGGCAAGAACGACGCC
ATCGTCGGCAAGGCCATCCACCAGTTGCGGGTGAATTTGTGGAAGAAGCATTTTGGCTTGAGCCAGGGGC
CAGGCGGTTTCGTCAAGCCGGCCAGCGAGTTGAGTGCTTATCTGTCCATCCCGGCGGCTCAAGAGGCCTG
GGAAGCTATACAAACATTAGCCAAGGAGAATACTCGTGCCTATGAACGGACTTTCAATTTTATTCCCCAA
AATATCAGCCAGACTCAACTGCAACTGACTCCAGAGCCGCCTAAAGGATTTGAGGACGGATTTCCCGCCT
CCATATGGCCAACCTGGGCATACAGAAAACCTGGCGAGTTAAGGGCGGGCGGACAACTGATGGAGCCGAT
GCCATATCAGGAAATCTTCTGGCGCTCATCTAATCTCACTTCGGTGAAAACCTTCCCACCACCCAACGGG
GTTTCCGGTTTCATCACGGCTCTACCAACCAGTTGGACCCGTGGTGAGCGCAATGATTCTGGCTTGAATC
TAAGCATCCTGGCACATCAGGACAGCAGATCGCTTCCCACCCAGGTCGCCATGAATGGAGATAGCTCGGC
ACAAGGAAAGCATCGCACATGA