SecReT6
Effector Protein ID: 116053805
SecReT6 ID150
T6SS typeA3
Gene symbol-
Locus tagPA14_01030
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]101003..101491 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA0085
DescriptionHcp protein
UniProt IDQ02UZ4
KEGG IDpau:PA14_01030
PDB ID4KSR, 4KSS
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.80E-46, Aligned region: 6..137
Protein Sequence: 162 a.a.     [Download]
>gi|116053805|ref|YP_788242.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MAVDMFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGGGGGAGKVNVQDLSFTKYIDKSTPNLM
MACSSGKHYPQAKLTIRKAGGENQVEYLIITLKEVLVSSVSTGGSGGEDRLTENVTLNFAQVQVDYQPQK
ADGAKDGGPVKYGWNIRQNVQA
-
Nucleotide Sequence: 489 bp     [Download]
>gi|116048575|ref|NC_008463.1|:101003-101491 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGGCTGTTGATATGTTCATCAAGATCGGCGACGTCAAGGGTGAGTCCAAGGACAAGACTCACGCCGAGG
AAATCGACGTGCTGGCATGGAGCTGGGGCATGTCCCAGTCCGGGTCGATGCACATGGGCGGTGGCGGCGG
CGCCGGCAAGGTCAACGTGCAGGACCTGTCGTTCACCAAGTACATCGACAAGTCCACGCCCAACCTGATG
ATGGCCTGCTCCAGCGGCAAGCACTATCCGCAGGCGAAGCTGACCATCCGCAAGGCCGGCGGCGAGAACC
AGGTCGAGTACCTGATCATCACCCTGAAGGAAGTCCTGGTGTCCTCGGTGAGCACCGGCGGCAGCGGTGG
CGAGGATCGCCTGACCGAGAACGTGACCCTGAACTTCGCCCAGGTCCAGGTCGACTACCAGCCGCAGAAG
GCGGATGGCGCGAAGGACGGCGGTCCGGTCAAGTACGGCTGGAACATCCGCCAGAACGTGCAGGCCTGA

Reference
(1) Zhang L et al. (2011). Pseudomonas aeruginosa tssC1 links type VI secretion and biofilm-specific antibiotic resistance. J Bacteriol. 193(19):5510-3. [PudMed:21784934] experimental
 
experimental experimental literature