SecReT6
Effector Protein ID: 116053811
SecReT6 ID150
T6SS typeA3
Gene symbol-
Locus tagPA14_01110
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]108629..110560 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA0091
Descriptiontype VI secretion system Vgr family protein
UniProt IDQ02UY8
KEGG IDpau:PA14_01110
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.90E-88, Aligned region: 26..326
Phage_base_V [PF04717], Evalue: 2.00E-26, Aligned region: 366..459
Protein Sequence: 643 a.a.     [Download]
>gi|116053811|ref|YP_788248.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MQLTRLVQVDCPLGPDVLLLQRMEGREELGRLFAYELHLVSENPNLPLEQLLGKPMSLSLELPGGSRRFF
HGIVARCSQVAGHGQFAGYQATLRPWPWLLTRTSDCRIFQNQSVPEIIKQVFRDLGFSDFEDALTRPYRE
WEYCVQYRETSFDFISRLMEQEGIYYWFRHEQKRHILVLSDAYGAHRSPGGYASVPYYPPTLGHRERDHF
FDWQMAREVQPGSLTLNDYDFQRPGARLEVRSNIARPHAAADYPLYDYPGEYVQSQDGEQYARNRIEAIQ
AQHERVRLRGVVRGIGAGHLFRLSGYPRDDQNREYLVVGAEYRVVQELYETGSGGAGSQFESELDCIDAS
QSFRLLPQTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWIRVSQAWAGKNWG
SMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGMKSRSSKGGTPANFNEIRMEDK
KGAEQLYIHAERNQDNLVENDASLSVGHDRNKSIGHDELVRIGNNRTRAVKLNDTLLVGGAKSDSVTGTY
LIEAGAQIRLVCGKSVVEFNADGTINISGSAFNLYASGNGNIDTGGRLDLNSGGASEVDAKGKGVQGTID
GQVQAMFPPPAKG
-
Nucleotide Sequence: 1932 bp     [Download]
>gi|116048575|ref|NC_008463.1|:108629-110560 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGCAACTGACCCGCCTGGTCCAGGTGGATTGCCCGCTGGGGCCGGACGTGCTGCTGTTGCAGCGCATGG
AGGGACGCGAGGAACTGGGACGGCTGTTCGCCTACGAGCTGCACCTGGTATCGGAAAATCCCAACCTGCC
GCTGGAGCAGTTGCTCGGCAAGCCGATGAGCCTGTCGCTGGAGCTGCCCGGCGGCAGCCGGCGCTTCTTT
CACGGTATCGTCGCGCGCTGTAGCCAGGTGGCCGGGCACGGCCAGTTCGCCGGCTACCAGGCCACCCTGC
GGCCCTGGCCGTGGCTGCTGACGCGCACCTCGGACTGCCGCATCTTCCAGAACCAGAGCGTGCCGGAGAT
CATCAAGCAGGTGTTCCGCGACCTCGGCTTTTCCGATTTCGAGGATGCCCTCACGCGCCCCTACCGCGAG
TGGGAATACTGCGTGCAGTACCGCGAGACCAGCTTCGACTTCATCAGCCGGCTGATGGAACAGGAGGGCA
TCTACTACTGGTTCCGCCATGAGCAGAAGCGCCACATCCTGGTGCTCTCCGACGCCTACGGCGCGCATCG
CAGCCCGGGTGGCTACGCCAGCGTGCCGTACTACCCGCCGACCCTCGGCCATCGCGAGCGCGACCACTTC
TTCGACTGGCAGATGGCACGCGAGGTCCAGCCCGGTTCGCTGACCCTCAACGACTACGACTTCCAGCGCC
CCGGCGCGCGCCTGGAGGTGCGTTCGAACATCGCCCGGCCGCACGCGGCGGCCGACTACCCGCTGTACGA
CTATCCCGGCGAATACGTGCAGAGCCAGGACGGCGAGCAGTACGCGCGCAACCGCATCGAGGCGATCCAG
GCGCAGCACGAGCGCGTGCGCCTGCGCGGCGTGGTGCGTGGGATCGGTGCCGGGCACCTGTTCCGCCTGA
GCGGCTATCCGCGCGATGACCAGAACCGCGAGTACCTGGTGGTCGGCGCCGAATACCGGGTGGTCCAGGA
ACTCTACGAAACCGGCAGCGGCGGCGCCGGCTCGCAGTTCGAGAGCGAGCTGGACTGCATCGACGCCAGC
CAGTCGTTCCGCCTCCTGCCGCAGACCCCGGTGCCGGTGGTGCGCGGTCCGCAGACCGCGGTGGTGGTGG
GGCCCAAGGGCGAGGAGATCTGGACCGACCAGTACGGCCGGGTCAAGGTGCACTTCCACTGGGATCGCCA
CGACCAGTCGAACGAGAACAGCTCCTGCTGGATTCGCGTGTCCCAGGCCTGGGCCGGGAAGAACTGGGGT
TCGATGCAGATCCCGCGGATCGGCCAGGAAGTGATCGTCAGCTTCCTCGAAGGCGACCCGGACCGGCCGA
TCATCACCGGGCGGGTCTACAACGCCGAGCAGACGGTGCCCTACGAGCTGCCGGCGAACGCCACCCAGAG
CGGGATGAAGAGCCGTTCGAGCAAGGGCGGCACGCCGGCCAACTTCAACGAGATCCGCATGGAGGACAAG
AAGGGCGCCGAGCAGTTGTACATCCACGCCGAGCGCAACCAGGACAACCTGGTCGAGAACGATGCCTCGC
TGTCGGTCGGCCACGACCGCAACAAGAGCATCGGCCACGACGAGCTGGTACGCATCGGCAACAACCGCAC
CCGCGCGGTGAAGCTCAACGACACCCTGCTGGTGGGCGGGGCGAAGAGCGACAGCGTCACCGGCACCTAC
CTGATCGAGGCCGGTGCGCAGATCCGCCTGGTCTGCGGCAAGAGCGTGGTGGAGTTCAACGCCGACGGCA
CCATCAATATCTCCGGCAGCGCCTTCAACCTCTACGCCAGCGGCAACGGCAACATCGACACCGGCGGCCG
CCTCGACCTCAATTCCGGCGGTGCCAGCGAGGTCGACGCCAAGGGCAAGGGCGTGCAGGGCACCATCGAC
GGCCAGGTACAGGCGATGTTTCCGCCGCCGGCGAAGGGCTGA