SecReT6
Effector Protein ID: 116053814
SecReT6 ID150
T6SS typeA3
Gene symbol-
Locus tagPA14_01140
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]111195..112514 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA0093
DescriptionTse6
UniProt IDQ02UY5
KEGG IDpau:PA14_01140
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 3.10E-13, Aligned region: 57..132
PAAR_motif [PF05488], Evalue: 3.10E-13, Aligned region: 271..281
DUF4150 [PF13665], Evalue: 0.0057, Aligned region: 63..83
DUF4150 [PF13665], Evalue: 0.0057, Aligned region: 104..125
DUF4150 [PF13665], Evalue: 0.0057, Aligned region: 327..353
Protein Sequence: 439 a.a.     [Download]
>gi|116053814|ref|YP_788251.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MVAGAVAGALIGAAVVAATAATGGLAAVILAGSIAAGGLSMFQIVKGLTTIFELPEPTTGVLIRGSFNVY
VNSRNAMRAGDDVSATCSGLPLNHPLWPFPVLIAEGSATVYINGKPAARLQSKMVCGAHIKTGSQNTFIG
GPTERVAFVLDLEEWLHTGLEALGLAALAGGLLLAAMAGVAALVGVVAIGGLMMGGMALLGDLGDRLGPG
YRDLFQGVAGMALLGFGPKMARLGNAPKGAPKTQVPKGFEKVYGKAPAAKAEIDAVADGLAAKHGGRVAK
APIKSRERAMQKINNDYKGDPTKIKDLARNTIIVEGDKVNTVAAELANRGAKVKVIDGNADPLGYSGVNS
TMNTKAGIPGEIQVNSPEMIYAKESEDMARILLGNDTYDAVAAKAGVPGGQGHKYYEDWRVLDPKSPEAQ
AIAEKSRAYYDAVRKGNGN
-
Nucleotide Sequence: 1320 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c112514-111195 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGGTCGCCGGAGCCGTGGCCGGAGCCCTGATCGGCGCCGCCGTGGTCGCCGCCACCGCCGCCACCGGCG
GCCTGGCCGCGGTGATCCTGGCCGGTTCGATCGCCGCCGGCGGGCTGTCGATGTTCCAGATCGTCAAGGG
CCTGACCACCATCTTCGAGCTACCCGAGCCGACCACCGGGGTGCTCATACGCGGCAGCTTCAACGTCTAC
GTGAACAGTCGCAACGCGATGCGCGCCGGCGACGACGTCTCCGCCACCTGCAGCGGCCTGCCGCTGAACC
ATCCGCTGTGGCCGTTCCCGGTGCTGATCGCCGAAGGCAGCGCCACCGTGTACATCAACGGCAAGCCGGC
GGCGCGCCTGCAGAGCAAGATGGTCTGCGGCGCGCACATCAAGACCGGCAGCCAGAACACCTTCATCGGC
GGCCCCACCGAGCGGGTGGCCTTCGTTCTCGATCTGGAGGAATGGCTGCACACCGGCCTCGAGGCGCTGG
GCCTGGCGGCCCTTGCCGGCGGCCTGCTGCTGGCGGCGATGGCCGGGGTCGCGGCGCTGGTTGGAGTGGT
CGCCATCGGCGGGCTGATGATGGGCGGCATGGCCCTGCTCGGCGACCTCGGCGACCGCCTCGGTCCCGGC
TACCGCGACCTGTTCCAGGGCGTGGCCGGCATGGCGCTGCTGGGCTTCGGACCGAAGATGGCACGGCTCG
GCAACGCACCCAAGGGCGCGCCGAAGACCCAGGTGCCGAAAGGCTTCGAGAAGGTCTATGGCAAGGCGCC
GGCAGCCAAGGCCGAGATCGACGCGGTGGCCGACGGACTGGCGGCTAAGCACGGCGGCAGGGTCGCCAAG
GCACCGATCAAGTCGCGCGAACGCGCCATGCAGAAGATCAACAACGACTACAAGGGCGATCCGACCAAGA
TCAAGGACCTGGCCCGCAACACCATCATCGTCGAAGGCGACAAGGTGAACACCGTTGCCGCCGAGCTGGC
CAACCGCGGCGCCAAGGTCAAGGTGATCGACGGCAACGCCGACCCGCTCGGCTACAGCGGGGTGAACTCG
ACGATGAACACCAAGGCCGGGATACCCGGCGAGATCCAGGTCAACTCGCCGGAGATGATCTACGCCAAGG
AGTCGGAGGACATGGCTCGCATCCTCCTCGGCAACGACACCTACGACGCGGTGGCGGCCAAGGCCGGCGT
ACCCGGAGGGCAGGGCCACAAGTACTATGAGGACTGGCGGGTACTGGATCCGAAGTCCCCGGAGGCCCAG
GCCATCGCCGAGAAGAGCCGGGCGTACTACGACGCAGTGAGGAAAGGCAATGGCAATTGA