SecReT6
Effector Protein ID: 116053976
hcpC
SecReT6 ID152
T6SS typeA1
Gene symbolhcpC
Locus tagPA14_03240
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]288454..288972 [-]
Productsecreted protein Hcp
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDQ02E95
KEGG IDpau:PA14_03240, pau:PA14_69560, pau:PA14_44890, pau:PA14_43070
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-41, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|116053976|ref|YP_788416.1| hcpC gene product [Pseudomonas aeruginosa UCBPP-PA14]
MATPAYMSITGTKQGLITAGAFTEDSVGNTYQEGHEDQVMVQGFNHEVIIPRDPQSGQPTGQRVHKPVVI
TKVFDKASPLLLAALTSGERLTKVEIQWYRTSAAGTQEHYYTTVLEDAIIVDIKDYMHNCQDPGNAHFTH
LEDVHFTYRKITWTHEVSGTSGSDDWRSPVAG
-
Nucleotide Sequence: 519 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c288972-288454 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGGCAACCCCCGCCTATATGTCCATCACCGGCACCAAGCAGGGCCTGATCACCGCCGGCGCCTTCACCG
AGGACTCGGTCGGCAACACCTATCAGGAAGGCCACGAGGACCAGGTGATGGTCCAGGGCTTCAACCACGA
AGTGATCATCCCGCGTGACCCGCAGTCCGGCCAGCCGACCGGCCAGCGCGTGCACAAGCCTGTGGTCATC
ACCAAGGTCTTCGACAAGGCCTCGCCGCTGCTGCTGGCCGCCCTGACCTCCGGCGAGCGCCTGACCAAGG
TCGAGATCCAGTGGTACCGCACCTCCGCCGCCGGCACCCAGGAGCACTACTACACCACCGTCCTGGAAGA
CGCGATCATCGTCGACATCAAGGACTACATGCACAACTGCCAGGACCCGGGCAACGCCCACTTCACCCAC
CTGGAAGACGTGCACTTCACCTACCGCAAGATCACCTGGACCCACGAAGTCTCCGGCACCTCCGGCTCCG
ACGACTGGCGCTCCCCGGTGGCAGGGTGA