SecReT6
Effector Protein ID: 116249141
-
SecReT6 ID147
T6SS typeA5
Gene symbol-
Locus tagpRL120477
StrainRhizobium leguminosarum bv. viciae 3841
Repliconplasmid pRL12 [GenBank: NC_008378] [Browse all T6SS(s) in this replicon]
Location [Strand]517603..518079 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorAtu4345
DescriptionHcp protein
UniProt IDQ1M3Y8
KEGG IDrle:pRL120477
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.60E-33, Aligned region: 4..134
Protein Sequence: 158 a.a.     [Download]
>gi|116249141|ref|YP_764982.1| hypothetical protein pRL120477 [Rhizobium leguminosarum bv. viciae 3841]
MPIYLQIDGIQGDATHEQHRKWMDIEAIHWNVARNMNTSAGSAANREASEPTVSEVILTKVSDSSSTKLF
QEACSGRTGKRSVIHLVTTGNPGDTYIEYSLENTLIASYSIDSNGDRPVETIKLNFTKMEVKYTPYDDKH
SPQSPMIASYDLATTKAA
-
Nucleotide Sequence: 477 bp     [Download]
>gi|116248676|ref|NC_008378.1|:517603-518079 Rhizobium leguminosarum bv. viciae 3841 plasmid pRL12, complete sequence
ATGCCGATTTATCTTCAGATCGACGGTATCCAGGGGGATGCTACCCACGAGCAGCATCGCAAATGGATGG
ATATCGAAGCCATCCACTGGAATGTAGCCCGCAACATGAACACGTCCGCTGGTTCGGCGGCGAACCGTGA
AGCTTCCGAGCCGACCGTTTCGGAAGTGATCCTCACCAAGGTCAGCGACTCCTCGTCGACCAAGCTTTTC
CAGGAGGCCTGCTCGGGCCGTACCGGCAAGCGCTCCGTCATCCATCTCGTCACCACGGGCAATCCTGGCG
ACACCTATATCGAGTACTCCCTCGAAAATACGCTGATCGCCAGCTACTCGATCGATTCCAACGGCGACCG
CCCGGTCGAGACGATCAAGCTGAACTTCACCAAGATGGAAGTGAAGTACACGCCTTACGACGACAAGCAC
TCGCCGCAGTCGCCGATGATCGCTTCTTACGATCTCGCGACCACCAAGGCCGCTTAA