SecReT6
Effector Protein ID: 116252468
rbsB
SecReT6 ID147
T6SS typeA5
Gene symbolrbsB
Locus tagRL2721
StrainRhizobium leguminosarum bv. viciae 3841
Repliconplasmid pRL12 [GenBank: NC_008380] [Browse all T6SS(s) in this replicon]
Location [Strand]2879719..2880648 [+]
ProductD-ribose-binding protein component of ABC transporter
Effector typeProtein
Homologous effectorRbsB
Description
UniProt IDQ1MFR3
KEGG IDrle:RL2721
PDB IDNA
Domain hit(s) vs Pfam Peripla_BP_4 [PF13407], Evalue: 1.20E-53, Aligned region: 30..284
Peripla_BP_1 [PF00532], Evalue: 2.90E-17, Aligned region: 28..280
Peripla_BP_6 [PF13458], Evalue: 9.60E-12, Aligned region: 54..260
Peripla_BP_3 [PF13377], Evalue: 1.20E-07, Aligned region: 34..88
Peripla_BP_3 [PF13377], Evalue: 1.20E-07, Aligned region: 152..296
DUF917 [PF06032], Evalue: 0.002, Aligned region: 70..115
DUF917 [PF06032], Evalue: 0.002, Aligned region: 180..201
DUF3798 [PF12683], Evalue: 0.0054, Aligned region: 42..65
DUF3798 [PF12683], Evalue: 0.0054, Aligned region: 165..279
Protein Sequence: 309 a.a.     [Download]
>gi|116252468|ref|YP_768306.1| rbsB gene product [Rhizobium leguminosarum bv. viciae 3841]
MKIARTMLASAALLGLMLGPVHAAELKKLGLAVANLQANFFNQIKQSVEAEAKKRGIEVITVDAKGDGPT
QVNQIQDLLTQKIDALIYIPAGAAAATVPVKLAKSAGIPVVNVDRNAEGAPGDTFLATDSVASAKAVCDY
ILKEAGGKGKMVIIHGQKGTTPEVDRSKGCAESLKAYPDVKVVAEQFSNIWSQDEGFQIMQNMLQANPDV
SIVFAQADGLALGAAQAIKVANPSQKIVVGGFDGDTAALEALSKGVFNVTATQQTQKMGRDAVENAAKLV
AGEKVPPVQLLDATLTTKENVAGFIANHP
-
Nucleotide Sequence: 930 bp     [Download]
>gi|116249766|ref|NC_008380.1|:2879719-2880648 Rhizobium leguminosarum bv. viciae 3841 chromosome, complete genome
ATGAAAATTGCGCGCACCATGCTCGCGTCTGCTGCCCTGCTCGGTCTCATGCTCGGCCCAGTACACGCGG
CGGAACTGAAGAAGCTCGGCTTGGCCGTTGCCAACCTTCAGGCAAACTTCTTCAACCAGATCAAGCAATC
GGTCGAAGCCGAAGCCAAGAAGCGCGGCATCGAAGTCATCACGGTCGACGCAAAGGGCGACGGGCCGACA
CAGGTCAATCAAATCCAGGACCTCCTGACCCAGAAAATCGACGCGCTGATCTACATTCCGGCCGGTGCGG
CGGCTGCGACCGTTCCGGTCAAGCTCGCGAAGAGCGCTGGTATCCCGGTCGTGAACGTTGACCGCAACGC
CGAGGGAGCACCCGGCGATACCTTCCTTGCAACGGATTCCGTCGCGTCTGCCAAGGCCGTGTGCGACTAC
ATTCTGAAGGAAGCCGGCGGCAAGGGGAAGATGGTCATCATCCACGGCCAGAAGGGCACGACGCCGGAAG
TCGATCGTTCGAAGGGCTGCGCTGAATCTCTCAAGGCATATCCGGACGTCAAGGTTGTCGCCGAGCAGTT
CTCAAACATCTGGAGCCAGGACGAAGGGTTCCAGATCATGCAGAATATGCTGCAGGCAAATCCGGACGTT
TCGATCGTGTTCGCCCAGGCCGACGGCCTCGCCCTTGGCGCCGCGCAGGCGATCAAGGTCGCCAATCCTT
CCCAGAAGATCGTGGTTGGCGGCTTCGATGGTGACACCGCAGCTCTCGAAGCGCTCAGCAAGGGTGTCTT
CAACGTAACTGCGACCCAGCAGACGCAGAAGATGGGCCGCGACGCGGTTGAAAACGCCGCCAAGCTTGTC
GCCGGAGAAAAGGTGCCACCGGTCCAGCTCCTGGATGCCACGCTGACAACCAAGGAAAACGTCGCAGGCT
TCATCGCCAACCATCCGTAA