SecReT6
Effector Protein ID: 117617709
-
SecReT6 ID157
T6SS typeA1
Gene symbol-
Locus tagAHA_1118
StrainAeromonas hydrophila subsp. hydrophila ATCC 7966
Repliconchromosome [GenBank: NC_008570] [Browse all T6SS(s) in this replicon]
Location [Strand]1211755..1212273 [+]
ProductHcpA-like protein
Effector typeProtein
Homologous effectorECA2866
DescriptionHcp protein
UniProt IDA0KHA8
KEGG IDaha:AHA_1118
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.30E-35, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|117617709|ref|YP_855659.1| unnamed protein product [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
MPTPCYISIEGKTQGNITAGAFTSDSVGNIFVQGHEDEMLVQEFQHVVTVPTDPQSGQPAGQRVHKPFKF
TVALNKAVPLMYNSLASGEMLPKVTLKWYRTSVEGKQEHFFSTVLTDATIVDIDCQMPHCQDPAKSDFTQ
LIQVSLAYRKINWEHTVAGTSGADDWRAPIEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|117617447|ref|NC_008570.1|:1211755-1212273 Aeromonas hydrophila subsp. hydrophila ATCC 7966 chromosome, complete genome
ATGCCAACTCCATGTTATATCAGCATCGAAGGTAAAACCCAGGGCAACATCACTGCCGGTGCCTTCACTT
CCGATTCCGTCGGCAACATCTTCGTACAAGGTCACGAAGACGAGATGCTGGTGCAAGAGTTCCAACACGT
CGTCACCGTACCGACCGATCCGCAATCTGGTCAGCCTGCTGGTCAGCGTGTCCACAAGCCGTTCAAGTTC
ACCGTTGCGCTGAACAAGGCTGTGCCGCTGATGTACAACTCGCTGGCGTCCGGCGAAATGCTGCCGAAAG
TGACCCTGAAGTGGTACCGCACCTCCGTCGAGGGCAAGCAGGAGCACTTCTTCTCTACCGTGCTGACCGA
TGCCACCATCGTCGATATCGACTGCCAGATGCCGCACTGCCAGGATCCGGCGAAGTCTGACTTCACCCAA
CTGATCCAGGTTTCTCTGGCCTATCGCAAGATCAACTGGGAGCACACCGTTGCCGGTACTTCCGGTGCAG
ATGACTGGCGCGCGCCGATCGAGGCCTAA