SecReT6
Effector Protein ID: 117619461
-
SecReT6 ID157
T6SS typeA1
Gene symbol-
Locus tagAHA_1119
StrainAeromonas hydrophila subsp. hydrophila ATCC 7966
Repliconchromosome [GenBank: NC_008570] [Browse all T6SS(s) in this replicon]
Location [Strand]1212752..1215535 [+]
ProductRhs element Vgr protein
Effector typeProtein
Homologous effectorABG57133
Descriptiontype VI secretion system Vgr family protein; evolved VgrG with C-terminal VIP-2 domain; ADP-ribosyltransferase
UniProt IDA0KHA9
KEGG IDaha:AHA_1119
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.40E-68, Aligned region: 30..325
Phage_base_V [PF04717], Evalue: 4.10E-22, Aligned region: 373..465
ADPrib_exo_Tox [PF03496], Evalue: 7.80E-13, Aligned region: 716..893
Protein Sequence: 927 a.a.     [Download]
>gi|117619461|ref|YP_855660.1| unnamed protein product [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
MADSTGLQFTVKVGALPESTFVVAEFALDEGLNRPFNLRLELASAQPDLDFGAVLDQPCELLVWYNGELQ
RRVCGVVSDFAQGDSGFRRTRYQLLVQPALWRLSLRQNSRIFQAQKPDEILSILLQEHGITDYAFALKNE
HAKREYCVQYRETDLDFVNRLAAEEGMFYFHEFEAGKHRIVFADDAAALTAGPELFFNLGNRSLEQGPYV
RQFHYREAVRPSDVELKDYSFKTPAYGLSRKKVGVELTHQRDTYQHFDFPGRYKEDPTGKAFAQHRLDAL
RNDAVAGSGKSNSAALLPGQTFSLTEHPNGSLNTDWQVVHIRHTGLQPQALEEEGGSGPTVYHNEFSVVK
ASTTWRARIGSPEAPHKPMVDGPQIVTVVGPDGEEIYCDEHGRVKLQFPWDRYGSSNDQSSCWVRVSQGW
AGGQYGMMAIPRIGHEVIVSFLEGDPDQPIITGRTFHATNRPPYELPANKTRTVLRTETHQGEGFNELRF
EDQAGKEEIYIHGQKDLNVLIENDAAWHIKHDEHRDIDNERVTRIKANDHLTVEGEKRDQIKADYSLTVD
ASLHQKLGQSLLMEAGSEVHHKAGMKIVMEAGAELTLKVGGSFVKLDASGVTLSGGSIKMNSGGSPGSGS
GWGGKAPIQPGNVEVPTPPPATLPAPAIHKSMESMAPLAKPCPAAPPPVPPPPAGGPPAPPPAPPQLAGG
PMMPPPPPPVAATGEGKKSAKKWATVEISKADEALRYYSAQGYTLLNNYLRDRPYKQREAIDTLLSRSYL
NDEPTSASEFDQAMKAYVADVEAGLAKLPASPDLDFVYRGLALDKPELAALKDQFTGVGNIIVEPGFMST
SPDKAWVNDTLLRIRLPAGHGGRLLGEAAHFKGEAEMLFPTQTRLRVDRVVSSMSGDFDSLLNTIPTSDN
ASDNRSRIKRLIEVSVL
-
Nucleotide Sequence: 2784 bp     [Download]
>gi|117617447|ref|NC_008570.1|:1212752-1215535 Aeromonas hydrophila subsp. hydrophila ATCC 7966 chromosome, complete genome
ATGGCAGACAGCACAGGATTACAATTTACCGTCAAGGTGGGGGCCCTGCCCGAGAGCACCTTCGTGGTGG
CCGAGTTTGCGCTGGATGAAGGGCTTAACCGGCCATTCAACCTGCGCCTTGAGCTGGCAAGTGCTCAGCC
CGACCTCGACTTTGGCGCCGTGCTGGACCAGCCGTGCGAGCTGCTGGTGTGGTACAACGGCGAGCTGCAG
CGCCGGGTGTGTGGGGTGGTGAGTGACTTCGCGCAAGGGGACAGCGGCTTTCGCCGCACCCGCTATCAGC
TGCTGGTGCAGCCGGCCCTGTGGCGACTCTCTTTGCGCCAGAACTCCCGCATCTTCCAGGCACAAAAGCC
CGATGAAATCCTCTCCATCCTGTTGCAAGAGCACGGCATCACCGATTACGCCTTTGCCCTGAAAAACGAG
CACGCCAAGCGGGAATACTGCGTTCAGTATCGCGAAACCGACCTCGATTTCGTGAACCGCCTCGCCGCGG
AAGAGGGGATGTTCTATTTCCACGAGTTTGAAGCGGGCAAACACCGCATTGTGTTTGCCGATGACGCGGC
CGCCCTGACCGCTGGCCCCGAGCTCTTCTTCAACCTCGGCAACCGTTCCCTCGAGCAAGGCCCCTATGTG
CGGCAGTTTCACTACCGGGAGGCAGTGCGCCCGTCGGATGTGGAGCTCAAAGACTACAGCTTCAAGACCC
CGGCTTATGGCCTTTCCCGCAAGAAGGTGGGGGTGGAGCTGACTCACCAGCGCGACACCTACCAGCACTT
CGATTTCCCGGGCCGCTACAAAGAGGACCCGACCGGCAAGGCCTTTGCCCAACATCGGCTGGATGCGCTG
CGCAATGACGCAGTGGCGGGCAGTGGCAAGTCCAACAGCGCGGCTCTGCTGCCGGGCCAGACGTTTTCAC
TCACCGAACACCCCAACGGCAGCCTCAACACCGACTGGCAAGTCGTCCATATCCGCCACACCGGCTTGCA
GCCACAGGCGCTGGAAGAGGAGGGGGGAAGTGGCCCCACCGTCTACCACAACGAATTTAGCGTGGTGAAA
GCGAGTACCACCTGGCGGGCGCGTATCGGCAGCCCGGAAGCCCCTCACAAGCCGATGGTGGACGGCCCGC
AGATTGTGACCGTGGTGGGCCCCGACGGGGAGGAGATTTACTGCGACGAGCACGGCCGGGTCAAGCTGCA
ATTCCCGTGGGACAGATATGGTAGTTCCAACGACCAGAGTTCCTGCTGGGTGCGAGTCTCCCAAGGATGG
GCCGGCGGCCAGTACGGCATGATGGCCATCCCGCGCATCGGCCACGAGGTCATCGTGAGCTTTCTGGAAG
GGGACCCCGACCAGCCCATCATAACGGGGCGAACCTTCCACGCCACCAACCGGCCACCCTACGAGTTGCC
GGCCAACAAGACCCGCACCGTGCTGCGCACCGAAACCCACCAGGGTGAAGGCTTCAACGAACTGCGCTTT
GAAGACCAGGCGGGCAAGGAAGAGATTTATATCCACGGTCAGAAAGACCTGAACGTGCTTATCGAAAATG
ATGCCGCCTGGCACATCAAACACGACGAGCATCGGGATATCGACAACGAGCGGGTGACCCGCATCAAGGC
CAACGATCACCTGACGGTGGAGGGCGAGAAGCGCGACCAGATAAAAGCCGACTACTCGCTGACGGTGGAT
GCGTCCCTTCACCAGAAGTTGGGGCAATCACTGCTGATGGAGGCGGGGAGCGAGGTGCACCACAAGGCGG
GTATGAAGATCGTGATGGAGGCCGGCGCCGAGTTGACGCTCAAGGTGGGTGGCAGCTTTGTTAAGCTGGA
TGCCAGTGGCGTCACGCTAAGCGGTGGCTCCATCAAGATGAATTCTGGCGGCAGCCCGGGTTCTGGCTCT
GGTTGGGGTGGTAAAGCCCCCATCCAGCCAGGCAATGTCGAGGTGCCAACACCACCACCAGCAACATTGC
CAGCCCCGGCCATTCACAAGAGCATGGAGTCCATGGCACCGCTGGCAAAGCCTTGTCCAGCAGCTCCACC
ACCTGTACCACCTCCGCCTGCCGGGGGCCCACCAGCTCCACCGCCCGCCCCACCCCAGCTTGCCGGAGGC
CCAATGATGCCACCGCCGCCGCCACCTGTTGCAGCCACAGGGGAAGGCAAAAAGTCGGCAAAGAAGTGGG
CGACGGTAGAGATATCCAAAGCGGATGAAGCACTTAGATACTATTCGGCGCAAGGGTACACATTGCTCAA
TAACTATTTGCGTGATCGCCCCTACAAGCAGCGAGAGGCCATCGATACCCTGCTTAGTCGCAGCTATTTG
AATGATGAGCCGACATCTGCGAGTGAGTTTGACCAGGCAATGAAGGCCTATGTTGCCGATGTGGAGGCTG
GTCTGGCGAAATTGCCGGCTTCACCCGATTTGGACTTCGTGTACCGGGGGTTGGCGCTGGACAAGCCGGA
GCTTGCAGCCCTGAAAGATCAGTTCACCGGGGTGGGCAATATCATTGTTGAGCCAGGATTCATGAGTACC
TCACCGGACAAGGCCTGGGTCAACGATACCTTGTTGAGGATCCGCCTGCCTGCCGGCCATGGTGGCCGTC
TGCTGGGGGAGGCTGCGCACTTCAAGGGGGAAGCAGAAATGCTGTTTCCGACCCAGACCAGACTCAGGGT
CGATCGAGTGGTTTCCTCCATGAGCGGAGATTTTGACTCCTTGCTCAATACGATTCCAACTTCTGACAAT
GCATCGGATAACCGCAGCAGGATCAAGCGACTGATTGAGGTTTCCGTATTATGA

Reference
(1) Suarez G et al. (2008). Molecular characterization of a functional type VI secretion system from a clinical isolate of Aeromonas hydrophila. Microb Pathog. 44(4):344-61. [PudMed:18037263] experimental
 
experimental experimental literature