SecReT6
Effector Protein ID: 117625049
-
SecReT6 ID156
T6SS typeA2
Gene symbol-
Locus tagAPECO1_3710
StrainEscherichia coli APEC O1
Repliconchromosome [GenBank: NC_008563] [Browse all T6SS(s) in this replicon]
Location [Strand]3128846..3130012 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorAHW84487
DescriptionTle4
UniProt IDA1AF08
KEGG IDecv:APECO1_3710
PDB IDNA
Domain hit(s) vs Pfam PGAP1 [PF07819], Evalue: 1.00E-07, Aligned region: 25..37
PGAP1 [PF07819], Evalue: 1.00E-07, Aligned region: 227..263
LCAT [PF02450], Evalue: 0.001, Aligned region: 244..296
Abhydrolase_6 [PF12697], Evalue: 0.0012, Aligned region: 240..269
Abhydrolase_5 [PF12695], Evalue: 0.0055, Aligned region: 209..265
Protein Sequence: 388 a.a.     [Download]
>gi|117625049|ref|YP_854037.1| unnamed protein product [Escherichia coli APEC O1]
MTSTMHMDRADKNKVGTVEIEDLRVIPVIFLPGVMGSNLMDKKGKSIWRYDDSMSLMGWSLPTSGPKERK
RLLHPDRVEVDNRGRIPAPPDAQEKLIQLGQQYPEDPSDKEAMDNYTQAVRDILDNIEPEAKLFGSRKDR
GWGEVANASYGSFLDVLQTALYRDKPTKKGETLSATYQQLLDVPLGLEYGPDSLDEEYLEVIRLYQFPVH
VVGYNWLGSNMLSAIRLQEQIKKIVGGYQKRGMKCHKVILVTHSMGGLVARYFSECLSGNTDVYGIVHGV
LPSIGAAATYTRMKRGTENPESNPEGYVISHILGRNAAEMVAVFSQSPGPMELLPMNDYGEEWLNIVDRD
GSTLTLPKNLPIKEGIAPEERTYAELYLNRENWWMRIY
-
Nucleotide Sequence: 1167 bp     [Download]
>gi|117622295|ref|NC_008563.1|:3128846-3130012 Escherichia coli APEC O1 chromosome, complete genome
ATGACATCGACGATGCATATGGACAGGGCCGATAAGAATAAAGTTGGCACCGTTGAAATTGAGGATCTAC
GGGTTATTCCGGTTATTTTTCTGCCCGGAGTCATGGGTTCAAACCTTATGGATAAGAAAGGAAAATCCAT
CTGGCGATATGATGACTCTATGAGTCTGATGGGCTGGTCACTACCTACATCAGGACCAAAAGAGAGGAAA
AGATTATTGCATCCTGACAGGGTGGAGGTCGATAATCGTGGGAGAATTCCCGCACCTCCGGATGCCCAAG
AAAAACTTATTCAGTTAGGTCAACAATATCCGGAGGACCCATCCGATAAAGAAGCAATGGATAATTACAC
TCAGGCAGTACGTGACATTTTGGATAATATAGAGCCAGAAGCGAAATTATTTGGTTCAAGAAAAGATCGC
GGCTGGGGAGAGGTTGCAAATGCTAGCTACGGTTCCTTTCTCGATGTATTACAAACAGCATTGTACCGGG
ACAAACCTACAAAGAAAGGTGAGACGTTAAGTGCGACCTACCAGCAACTACTCGATGTACCTTTGGGTTT
GGAGTATGGTCCTGACTCACTTGATGAAGAGTATCTTGAAGTCATAAGGTTGTATCAATTTCCGGTCCAT
GTCGTTGGCTATAACTGGCTTGGTTCTAATATGCTCTCAGCAATCAGACTACAAGAACAGATCAAGAAAA
TTGTTGGAGGCTATCAAAAACGAGGAATGAAATGCCATAAAGTTATTCTGGTTACGCATTCAATGGGAGG
ACTAGTGGCAAGGTACTTTTCAGAGTGTCTTTCGGGGAATACGGATGTCTACGGTATTGTTCATGGCGTA
TTACCATCAATTGGTGCTGCGGCGACATATACCCGAATGAAACGTGGAACTGAAAACCCAGAGTCAAATC
CGGAAGGGTATGTTATCAGTCATATCTTAGGTCGTAATGCAGCTGAAATGGTAGCTGTTTTTTCCCAGTC
GCCAGGACCAATGGAATTACTACCCATGAATGATTATGGTGAAGAGTGGCTTAATATTGTCGATCGTGAT
GGTAGTACATTAACGCTCCCTAAAAATCTTCCCATTAAAGAAGGTATTGCCCCCGAAGAACGCACCTACG
CTGAACTTTATCTAAATAGAGAAAATTGGTGGATGAGAATCTATTGA