SecReT6
Effector Protein ID: 118497660
-
SecReT6 ID158
T6SS typeB
Gene symbol-
Locus tagFTN_1069
StrainFrancisella novicida U112
Repliconchromosome [GenBank: NC_008601] [Browse all T6SS(s) in this replicon]
Location [Strand]1128155..1130653 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorFTN_1069
DescriptionOpiB-1
UniProt IDA0Q6U1
KEGG IDftn:FTN_1069
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 832 a.a.     [Download]
>gi|118497660|ref|YP_898710.1| hypothetical protein FTN_1069 [Francisella novicida U112]
MAIDLLKLQKKLGYDVDTGGMCYGIAYMAIQAIIRDDLAAYISRIEYLEKTLSQHNNNEDAAINEIVEKI
NVAYEKRKNKQNLDCDEIKLLDILNWLDGVQIYHNYNNLLYGGQNYKNATNFFSANTNQNEKENRKIFVI
AKELNILTKELIDDIFDKIDNSKEPIAFSLSTPDHIISIGKSSNYKPIYLINHDIHKHILNERSLYSEVF
CAFKYSMRIALSIFRYSYQEENISIKYVTNNLDKDDLCNLLCLALQDGYVEAIKVYIEGISNLSGINKQQ
LLAAKKKNDGAPGLCLALQNGHAEAIKAYIEGIFNIPGIDKQQLLAAKRKDGTPGLFMALQNGHAEAIKV
YIEGISNLSGINKQQLLAAKRKDGTPGLYIALQNGHVEAIKIYIDAISNLGGIDKQELLAAKIPDGTPGL
YVALYNGHAEAIKVYIEAISNFPGIDKQELLAAKMSDGTPGLCLALQNGHAEAIKVYIEEISNFPGIDKQ
ELLAAKMPDGTPGLFMALQNGHAEAIKVYIEAIFNLPGINKQQLLTPKMSDGTPGLFIALQNGHAEAIKI
YIEGISNLSGINKQQLLTPKMSDGTPGLFMALQNGHAEAIKVYIEGISNFPGIDKQQLLAAKRKDGTPGL
CLALQNGHVEAIKIYIDAISNLGGIDKQELLAAKIPDGTPGLYVALYNGHAEAIKVYIDAISNLSGIDKQ
QLLAAKKQNGTPGLFMALQKGHAEAIKAYIEGISNFSGIDKQQLLAAKNQRGTPALCMALYNGHAEAIKV
YIEGIFNLPGINRRELLAAKMPDGTPGLHIALQQGHSQAVKTYREMISKLKILSNGLPGFLL
-
Nucleotide Sequence: 2499 bp     [Download]
>gi|118496615|ref|NC_008601.1|:c1130653-1128155 Francisella novicida U112 chromosome, complete genome
ATGGCTATTGATCTATTAAAACTACAAAAAAAACTTGGATATGATGTTGATACTGGTGGAATGTGTTACG
GAATAGCTTATATGGCTATACAAGCTATTATAAGAGATGATTTAGCAGCATATATTAGCAGAATAGAATA
TTTAGAAAAAACATTATCGCAACATAACAATAATGAAGATGCTGCGATTAATGAAATTGTAGAAAAAATA
AATGTAGCATATGAAAAAAGGAAGAATAAACAAAATCTAGATTGTGATGAAATAAAATTATTAGATATAT
TAAATTGGCTTGATGGAGTTCAAATATACCACAATTACAATAATCTATTATATGGAGGTCAAAATTATAA
GAATGCAACAAACTTTTTCTCAGCTAATACAAATCAAAATGAAAAAGAAAATAGAAAAATCTTTGTTATA
GCTAAAGAATTAAATATATTAACAAAAGAGTTGATAGATGATATTTTTGATAAGATTGATAACAGTAAAG
AACCTATTGCTTTTTCATTAAGCACCCCAGATCATATTATTTCGATAGGTAAAAGCTCTAATTATAAACC
GATATATTTAATCAATCATGATATTCATAAACATATATTAAATGAGAGATCGTTATACAGTGAAGTATTT
TGTGCATTTAAGTATTCGATGAGGATAGCTTTGAGCATTTTTAGATATTCATACCAAGAAGAAAATATTT
CAATTAAATATGTCACTAATAATTTAGATAAAGATGATTTATGTAACTTATTATGTCTAGCTTTGCAAGA
TGGATACGTAGAAGCTATCAAAGTTTATATAGAAGGTATATCTAATCTTAGTGGAATTAATAAACAACAA
CTATTAGCTGCTAAAAAGAAAAATGATGGAGCTCCAGGATTATGTCTAGCTTTACAAAATGGCCACGCAG
AAGCTATCAAAGCTTATATAGAGGGTATATTTAATATTCCTGGAATTGATAAACAACAACTATTAGCTGC
TAAAAGGAAGGATGGAACACCAGGGTTATTTATGGCTTTGCAAAATGGCCACGCAGAAGCTATCAAAGTT
TATATAGAAGGTATATCTAATCTTAGTGGAATTAATAAACAACAACTATTAGCTGCTAAAAGGAAGGATG
GAACACCGGGATTATATATTGCTTTGCAAAATGGTCACGTAGAAGCTATCAAAATTTATATAGATGCGAT
ATCTAATCTTGGTGGAATTGATAAACAAGAATTATTAGCTGCTAAAATACCGGATGGAACACCGGGATTA
TATGTGGCTTTGTATAATGGTCACGCAGAAGCTATCAAAGTTTATATAGAGGCGATATCTAATTTTCCTG
GAATTGATAAACAAGAATTATTAGCTGCTAAAATGTCAGATGGAACACCAGGGTTATGTCTAGCTTTGCA
AAATGGTCACGCAGAAGCTATCAAAGTTTATATAGAGGAGATATCTAATTTTCCTGGAATTGATAAACAA
GAATTATTAGCTGCTAAAATGCCGGATGGAACACCAGGGTTATTTATGGCTTTGCAAAATGGTCACGCAG
AAGCTATCAAAGTTTATATAGAGGCGATATTTAATCTTCCTGGAATTAACAAACAACAACTATTAACTCC
TAAAATGTCAGATGGAACACCAGGGTTATTTATAGCTTTGCAAAATGGTCACGCAGAAGCTATCAAAATT
TATATAGAGGGGATATCTAATCTTAGTGGAATTAATAAACAACAACTATTAACTCCTAAAATGTCAGATG
GAACACCAGGGTTATTTATGGCTTTGCAAAATGGTCACGCAGAAGCTATCAAAGTTTATATAGAGGGGAT
ATCTAATTTTCCTGGAATTGATAAACAACAACTATTAGCTGCTAAAAGGAAGGATGGAACACCAGGGTTA
TGTCTAGCTTTGCAAAATGGTCACGTAGAAGCTATCAAAATTTATATAGATGCGATATCTAATCTTGGTG
GAATTGATAAACAAGAATTATTAGCTGCTAAAATACCGGATGGAACACCGGGATTATATGTGGCTTTGTA
TAATGGTCACGCAGAAGCTATCAAAGTTTATATAGATGCGATATCTAATCTTAGTGGAATTGATAAACAA
CAACTATTAGCTGCTAAAAAACAGAATGGAACACCAGGGTTATTTATGGCTTTGCAAAAAGGTCACGCAG
AAGCTATCAAAGCCTATATTGAAGGTATATCTAATTTTAGTGGAATTGATAAACAACAACTATTAGCTGC
TAAAAATCAGCGTGGAACACCAGCATTGTGTATGGCTTTGTATAATGGCCACGCAGAAGCTATCAAAGTT
TATATAGAGGGGATATTTAATCTTCCTGGAATTAATAGACGAGAATTATTAGCTGCTAAAATGCCGGATG
GAACACCAGGGTTACATATAGCTTTGCAACAGGGTCATTCACAAGCTGTTAAAACTTATAGAGAAATGAT
ATCTAAATTGAAGATCTTAAGTAATGGATTACCAGGATTTTTGCTTTAG

Reference
(1) Eshraghi A, Kim J, Walls AC, Ledvina HE, Miller CN, Ramsey KM, Whitney JC, Radey MC, Peterson SB, Ruhland BR, Tran BQ, Goo YA, Goodlett DR, Dove SL, Celli J, Veesler D, Mougous JD (2016). Secreted Effectors Encoded within and outside of the Francisella Pathogenicity Island Promote Intramacrophage Growth. Cell Host Microbe. 20(5):573-583. [PudMed:27832588] experimental
 
experimental experimental literature