SecReT6
Effector Protein ID: 118497889
pdpA
SecReT6 ID158
T6SS typeB
Gene symbolpdpA
Locus tagFTN_1309
StrainFrancisella novicida U112
Repliconchromosome [GenBank: NC_008601] [Browse all T6SS(s) in this replicon]
Location [Strand]1378294..1380756 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorFTN_1309
DescriptionpdpA
UniProt IDA0Q7H0, Q7X3I9
KEGG IDftn:FTN_1309
PDB ID6U9G, 6U9F
Domain hit(s) vs Pfam NA
Protein Sequence: 820 a.a.     [Download]
>gi|118497889|ref|YP_898939.1| hypothetical protein FTN_1309 [Francisella novicida U112]
MIAVKDITDLNIQDIISQLTSEVINGDTTPSSAKFACEINSYIINYNLSNINLINTQLKNTKILYRKGLI
SKLDYEKYKRYCIISRFKNNIDEFILYFSTNYKDSQSLKIAIKELQNSCSSSLILELPHDYIRKIDVLLT
SIDSAIQRSSDLNKTIIKQLNKLRSSLSRYIGYNNVLQKQEITINIKPINKNFELEDISFVSTRNKQYFK
HNSLTLKNPHIEKLEVCENIYGINGWLTFDLAYINNHKDFNFLLSPNQPILLDIQINDSFNFYKKESKKD
HHKRTTRFIAIGFNSNSIDIHENFEYSIYSYTKNVSSGVKKFKIQFHDPLKALWTKHKPSYIALNKSLDD
IFKDNFFFDSLFSLDTNKSNNLKIRIPQAFISTVNRNFYDFFIQQLEQNKCYLKYFCDKKSGKVSYHVVD
QVDNDLQRNIVNSDEDLKDKLSPYDISCFKKQILISNKSNFYVKEKNICPDVTLNTQRKEDRKISDTLVK
PFSSILKDNLQSVEYIQSNNDDKQEIITTGFEILLTSRNTLPFLDTEITLSKLDNDQNYLLGATDIKSLY
ISQRKLLFKRSKYCSKQLYENLHNFHYKSDSESDVYEKIAFTKYPSLTHDNSITYKIKDYSNLTPEYPKY
KSFSNFYINGRITIGENVNNDSKKAYKFFKNHKPEESSIAEFQENGEKGTSAILNSKADILYAIEIAKEM
LSDKSSDKPIIYLPLKVNINSANNQFIPLRNDDIILIEIQSFTKGEIIELISNSAISTKKAQQQLLQRQL
LGSKENCEMAYTQTSDSETFSLTQVNEDCENSFLINDKKGIFLRYKSKGN
-
Nucleotide Sequence: 2463 bp     [Download]
>gi|118496615|ref|NC_008601.1|:1378294-1380756 Francisella novicida U112 chromosome, complete genome
ATGATAGCAGTAAAAGATATAACTGATCTAAATATACAAGACATAATTAGTCAGTTAACTTCTGAAGTTA
TAAATGGCGACACAACCCCTTCTTCCGCCAAGTTTGCTTGTGAAATTAATAGCTATATTATTAATTACAA
CCTATCAAACATTAATCTTATTAATACTCAACTAAAAAATACAAAGATACTTTATAGAAAAGGCTTGATA
TCTAAGCTTGATTACGAAAAATATAAAAGATATTGCATAATATCTAGATTTAAAAATAACATAGATGAAT
TTATCTTATATTTTTCGACAAACTATAAAGACTCTCAAAGCTTAAAAATCGCAATTAAAGAATTACAAAA
CTCATGCTCATCAAGTTTAATTCTTGAGCTCCCTCATGATTACATAAGAAAAATTGATGTCTTACTAACT
AGTATAGATAGTGCAATACAAAGATCAAGCGATCTCAACAAAACAATTATAAAACAGTTAAATAAGCTTA
GAAGCAGCCTTTCACGATATATTGGGTATAATAATGTACTGCAAAAACAAGAAATTACTATAAATATAAA
GCCTATTAATAAAAATTTTGAACTTGAGGATATAAGTTTTGTATCAACTAGAAATAAGCAATATTTTAAG
CATAACTCTCTTACACTTAAAAACCCTCATATTGAAAAATTAGAAGTATGTGAAAATATCTACGGCATAA
ACGGCTGGTTAACTTTTGATTTAGCATATATCAATAATCACAAAGACTTTAACTTTCTATTAAGCCCAAA
TCAACCCATATTGCTTGATATTCAAATTAATGATAGCTTCAACTTTTACAAAAAAGAATCTAAAAAAGAT
CATCATAAGAGAACAACCCGTTTTATAGCCATTGGCTTTAATTCAAACAGTATAGATATTCATGAGAACT
TTGAATATAGCATATATTCTTATACCAAAAATGTTTCTTCAGGAGTAAAAAAATTTAAAATACAATTCCA
TGACCCACTAAAAGCACTTTGGACTAAGCACAAACCATCCTATATAGCCTTGAACAAAAGCTTAGATGAT
ATCTTTAAAGATAATTTTTTCTTTGATAGTTTATTTTCTTTAGATACCAACAAAAGTAATAATCTAAAAA
TACGTATACCACAAGCATTTATTTCTACAGTTAATCGAAATTTTTATGATTTCTTTATTCAACAACTTGA
GCAAAATAAATGCTATTTAAAATATTTCTGTGATAAGAAGAGTGGCAAAGTAAGCTATCATGTTGTAGAT
CAAGTAGATAATGACTTACAAAGGAATATCGTAAATTCAGATGAAGATTTAAAAGACAAACTATCTCCTT
ATGATATAAGCTGCTTCAAAAAACAAATTCTAATCTCAAATAAGTCAAACTTTTATGTTAAGGAAAAAAA
TATATGTCCTGATGTGACTTTAAACACTCAAAGAAAGGAAGACCGAAAGATTTCAGATACCTTAGTAAAG
CCATTCTCATCCATACTCAAGGATAACTTACAATCTGTAGAGTATATACAAAGTAATAATGATGATAAAC
AAGAAATTATTACTACAGGATTTGAGATATTACTGACATCAAGAAATACTCTGCCCTTCTTAGATACTGA
AATTACTCTTTCTAAACTAGACAATGATCAAAACTATCTTTTAGGCGCAACAGATATAAAAAGCTTATAT
ATAAGTCAAAGAAAGCTATTATTTAAAAGAAGTAAATACTGCTCTAAACAACTATATGAAAACTTACATA
ATTTTCACTATAAAAGTGATTCTGAATCAGACGTATATGAAAAAATTGCTTTTACTAAATACCCTAGTCT
GACACATGACAACTCAATAACTTATAAAATTAAGGATTATAGTAATCTAACTCCTGAATATCCTAAGTAC
AAAAGTTTTAGTAACTTTTATATTAATGGTAGAATAACGATTGGAGAAAATGTTAATAATGACTCCAAAA
AAGCTTATAAATTCTTTAAAAATCATAAGCCAGAAGAAAGCTCAATCGCAGAATTTCAAGAAAATGGTGA
AAAAGGTACTTCAGCTATACTAAATAGTAAGGCTGATATCTTATACGCAATAGAAATTGCCAAGGAAATG
TTGTCTGATAAATCATCAGATAAGCCAATCATATACTTACCTCTAAAAGTAAACATAAATTCTGCTAATA
ATCAATTTATACCATTGAGAAATGACGATATTATCTTAATTGAAATACAGTCTTTTACTAAAGGTGAAAT
TATTGAGTTAATTTCGAACTCTGCCATATCAACAAAGAAAGCTCAGCAGCAACTACTACAACGACAACTT
CTTGGATCTAAAGAAAACTGTGAAATGGCATATACCCAAACAAGTGATAGCGAGACATTCTCACTAACTC
AAGTAAATGAAGATTGTGAGAATTCTTTTTTGATAAATGATAAAAAAGGTATTTTTCTAAGATATAAATC
AAAAGGAAATTAA

Reference
(1) Eshraghi A, Kim J, Walls AC, Ledvina HE, Miller CN, Ramsey KM, Whitney JC, Radey MC, Peterson SB, Ruhland BR, Tran BQ, Goo YA, Goodlett DR, Dove SL, Celli J, Veesler D, Mougous JD (2016). Secreted Effectors Encoded within and outside of the Francisella Pathogenicity Island Promote Intramacrophage Growth. Cell Host Microbe. 20(5):573-583. [PudMed:27832588] experimental
 
experimental experimental literature