SecReT6
Effector Protein ID: 118497899
pdpC
SecReT6 ID158
T6SS typeB
Gene symbolpdpC
Locus tagFTN_1319
StrainFrancisella novicida U112
Repliconchromosome [GenBank: NC_008601] [Browse all T6SS(s) in this replicon]
Location [Strand]1391204..1395181 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorFTN_1319
DescriptionpdpC
UniProt IDA0Q7I0
KEGG IDftn:FTN_1319
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1325 a.a.     [Download]
>gi|118497899|ref|YP_898949.1| hypothetical protein FTN_1319 [Francisella novicida U112]
MNDKYELNIYFEKIELPKTADFNMISKHDIKELRVDANLKKKIHLLQFDEDYLAYMRSLRAIHPSKIAMQ
KIKSIRNKEDSFIIAIFSLDKIIHKTKFISFGHKTVIFDFKKLWGLVDFVIVHTSNKTWVNHKLTSFMPS
ITYCNQNIIHLAYHSDFLYIYHTPEFMDDINVDRENRRELVAKIPDPYWVRADTKENKININSEEENIEK
DLKKITKLKNFEISANDIFFSKAIKAAPRLQHKNKSKLFNSLAIENNEKIKRDIIDYAISNAWYKNEGLL
ENLMTFLDALVVRHLYLIAVYSVYEIEIGIKSVKPEYSKLLKAGLLNKDIQNQLIYDQKKISNIIWLGET
FHGLDIEEAEDLCELIDQGDINPKINPINPEKLYRAYKENYGNEALSFREYKEKYNFLDNDKLREEHANK
LSSILEDPKFRVLSYINAFLCSTKNYLVPYGYLGSNPLTYYNCMLETGKRRTSKEAYFADIRNKLFMVCY
LPGFLSSVIADDDFIDWYSNKKENQELLKNSYLNNLYKSKQKYIKDFIDLDIIKLLKQTSSQIKPSYIPV
AFRYGAFASTTALIRSNANVSNRMEFELYDSPERLHNQYSEKEEMIMPKSVNNPKDHSIDNGISLFSLNL
TNEKEDGLRKVMLKVAQLYNLDFKVGISGNLDQAMTQALILGMATTKKNGDILLDEDQMLYMTYLYCIFM
AHSVDHTVDEILMSANTYLLNSEEVKYPIFNIADFFARPVFGLSKDKEFKSLVEKYENSLKPNSKILKEN
YISRVVTLSEVYEDIYNLNCLYSSLSEGSLYNLLSTHSERHCTLLEQYSRKKKAEIGLVQDGEKIKVVNN
YSGYAAINQYQRFVSLGRMYDSGAKYSSSHKKQIEKDFNLYLPDKEQINYLKYNFKDNKFDAVYKNKKSK
EKNQSHIVYAKKQNTRYCYGYFNDFFVKNRITTFYKIKDKSGNYLVNLHNEKYSFATPNSDSKIYRVSPE
LLNNRDDFKRVSKDIIKSYKYISFDKQKEDIVKNFGKNLYHTNYEIWVGLSHQAISCFSVLDNIDTQEAA
NTFIDALYYVRLMQLYYGKTIPFLWISSEIVRYSSSETHYYIPTEENFENILKIALNNASKPVIERFLII
LNIYNSTIDNNALILIRCRLPIILFEYEEQKLKLKALQKCADSYKKNNYKNEINFSAWFESIFHVQNLSL
SPNYIGNNILILSLVEELKPKCSEYKKNMINQQITAKANELNFYQLLIRLIEISTYHRILTKSIITNTTS
LLYDILNKPEFQTINKLINKLFIYKNKDLNTDKYKAFHTKLITIESTYKKINSLYKSDFFKKISS
-
Nucleotide Sequence: 3978 bp     [Download]
>gi|118496615|ref|NC_008601.1|:1391204-1395181 Francisella novicida U112 chromosome, complete genome
ATGAACGACAAATATGAACTAAATATCTATTTTGAGAAAATAGAGTTACCTAAAACAGCAGATTTCAATA
TGATAAGCAAGCATGATATTAAAGAACTCAGAGTAGATGCTAATTTAAAAAAGAAAATACACTTATTACA
ATTTGATGAAGATTATTTAGCATATATGAGGAGCTTAAGAGCTATTCATCCCTCAAAAATAGCAATGCAA
AAAATTAAATCAATTCGCAATAAAGAAGATTCTTTTATAATAGCCATTTTTTCTTTAGATAAAATAATTC
ACAAAACTAAATTTATCTCTTTTGGACATAAAACCGTTATTTTTGATTTTAAAAAACTATGGGGATTAGT
TGATTTCGTAATAGTTCATACAAGTAATAAAACCTGGGTTAATCATAAGTTAACATCATTTATGCCATCA
ATTACATACTGTAATCAAAACATCATCCATTTAGCATACCATTCTGATTTTTTATATATTTATCATACTC
CAGAATTTATGGATGATATAAATGTAGATCGAGAAAATAGAAGAGAGTTAGTGGCAAAAATTCCCGATCC
ATATTGGGTAAGAGCTGATACTAAAGAAAATAAAATCAATATTAATTCTGAAGAGGAAAATATAGAAAAA
GATTTAAAAAAAATAACTAAATTAAAAAATTTTGAAATAAGCGCAAATGATATTTTTTTCTCAAAAGCTA
TAAAAGCAGCTCCAAGATTACAACATAAAAATAAGAGTAAATTATTTAATTCATTAGCGATTGAAAATAA
TGAAAAAATCAAACGTGACATAATTGATTATGCAATATCTAATGCTTGGTATAAAAACGAGGGGTTACTT
GAAAATCTAATGACATTTTTAGACGCGCTAGTCGTAAGACATCTCTACTTAATAGCAGTTTACTCAGTTT
ATGAAATAGAAATAGGTATTAAATCAGTAAAACCTGAGTATAGCAAATTATTAAAAGCTGGCCTATTGAA
CAAAGATATTCAAAATCAATTGATATATGATCAAAAGAAAATTAGCAATATTATTTGGCTTGGTGAAACA
TTTCATGGTTTAGATATTGAAGAAGCAGAAGATTTATGTGAACTTATTGACCAAGGCGATATTAATCCAA
AAATTAATCCTATAAATCCTGAAAAGCTATATAGAGCCTATAAAGAAAATTATGGAAATGAAGCGTTAAG
CTTTAGAGAATACAAAGAAAAATATAATTTTTTAGATAATGATAAGCTTAGAGAAGAACATGCAAATAAA
CTTTCAAGCATATTAGAAGATCCAAAATTTAGAGTTCTTAGCTATATAAATGCATTTTTATGTTCAACTA
AAAATTATCTAGTACCTTATGGGTATTTAGGAAGTAATCCTCTTACATACTATAATTGTATGCTAGAAAC
CGGAAAACGTAGAACATCAAAAGAAGCATATTTTGCTGATATAAGAAACAAATTGTTTATGGTATGCTAT
CTTCCTGGCTTCTTGAGCTCTGTAATTGCTGATGATGACTTTATAGACTGGTATTCTAATAAGAAAGAAA
ATCAAGAATTACTCAAAAACTCTTATTTGAACAATTTATATAAGTCAAAGCAGAAATATATAAAAGATTT
TATAGATCTTGATATTATTAAACTTCTAAAACAGACATCATCTCAAATCAAGCCAAGCTATATACCAGTA
GCTTTTAGATATGGTGCATTTGCCTCAACAACTGCTTTGATAAGATCAAATGCAAATGTTTCTAATCGAA
TGGAGTTTGAATTATATGACTCACCTGAAAGACTACATAATCAATACTCAGAAAAAGAGGAAATGATTAT
GCCAAAATCGGTTAATAACCCCAAGGATCACTCAATTGACAATGGAATATCTTTATTTAGCCTTAATCTA
ACAAATGAAAAAGAAGATGGACTTCGAAAAGTTATGTTGAAAGTTGCACAACTATATAATCTTGATTTCA
AGGTAGGTATCTCAGGAAATTTAGATCAAGCAATGACTCAGGCATTAATACTTGGGATGGCAACTACAAA
AAAAAATGGCGATATCTTACTTGATGAAGATCAAATGCTATATATGACATACTTATACTGCATTTTCATG
GCACATAGTGTCGATCATACTGTAGATGAAATACTAATGTCTGCAAATACTTATCTGTTAAATTCTGAAG
AGGTAAAGTATCCTATATTTAATATAGCTGATTTTTTTGCTAGGCCTGTATTTGGACTCTCTAAGGATAA
AGAGTTTAAATCATTAGTTGAAAAGTATGAAAATAGCCTAAAACCTAATTCAAAAATTCTCAAAGAGAAT
TATATAAGTAGAGTAGTCACACTATCTGAAGTATATGAAGATATATATAACTTAAATTGTTTATATAGTT
CTCTCTCAGAAGGATCCTTGTATAATCTACTATCAACTCACAGTGAAAGACACTGTACTTTATTAGAGCA
GTATTCTCGCAAGAAGAAAGCTGAGATAGGATTAGTCCAAGATGGAGAGAAAATAAAAGTCGTAAACAAC
TACAGTGGCTATGCTGCGATTAATCAATATCAACGTTTTGTATCACTAGGCAGAATGTATGATAGTGGTG
CAAAATACTCCTCTTCTCATAAAAAACAGATAGAAAAAGATTTCAACTTATACTTACCAGATAAAGAACA
GATAAATTATCTAAAATATAACTTTAAAGATAATAAATTTGATGCTGTTTATAAAAACAAAAAGAGCAAA
GAAAAAAATCAAAGCCATATTGTGTATGCAAAAAAACAAAATACGCGATATTGCTACGGATATTTTAACG
ATTTTTTCGTTAAAAATAGAATTACGACTTTTTATAAAATAAAAGATAAATCAGGAAACTATTTAGTAAA
CTTACATAATGAAAAATATAGTTTCGCAACACCTAATTCAGATTCTAAAATATATAGAGTTTCACCAGAA
TTACTTAACAATAGAGATGATTTTAAAAGAGTATCTAAAGATATTATAAAATCATATAAATATATTAGTT
TTGATAAACAAAAGGAAGATATAGTTAAAAATTTTGGTAAAAACTTATATCATACTAATTATGAGATATG
GGTTGGGCTATCACATCAAGCTATATCATGTTTTTCAGTTTTAGATAACATAGATACACAAGAAGCTGCT
AATACTTTTATCGATGCTTTATATTATGTTAGATTAATGCAATTATATTATGGCAAAACTATACCTTTTT
TGTGGATTAGTAGCGAAATTGTAAGATATTCTTCATCAGAAACTCACTACTATATACCAACAGAAGAAAA
CTTTGAAAATATACTTAAAATTGCTCTTAATAATGCCTCAAAACCAGTAATAGAAAGATTCTTAATTATT
CTTAACATATATAATAGTACTATTGATAATAATGCTTTAATTTTGATACGATGCCGTTTACCAATAATAT
TATTTGAATATGAAGAGCAGAAACTTAAATTAAAAGCTTTGCAAAAGTGTGCTGATTCTTATAAAAAAAA
TAATTATAAAAATGAAATTAACTTTAGTGCTTGGTTTGAATCTATATTTCATGTTCAAAACTTATCCTTA
TCTCCTAATTATATTGGCAATAATATTTTAATCTTGAGTTTAGTTGAAGAATTAAAACCAAAATGTAGTG
AATATAAAAAAAACATGATTAACCAACAAATTACAGCTAAAGCAAACGAGTTAAACTTTTATCAACTTCT
AATAAGACTTATTGAAATATCAACCTATCATAGAATACTTACGAAATCAATCATAACTAATACAACCTCG
TTACTTTATGACATATTAAATAAACCAGAATTTCAAACAATAAATAAATTAATAAATAAGCTATTTATTT
ATAAAAACAAGGATCTAAATACTGATAAATATAAAGCCTTTCACACTAAGCTTATAACTATTGAAAGTAC
CTATAAAAAAATAAATAGCCTATATAAATCAGACTTTTTTAAAAAAATATCGTCATAG

Reference
(1) Eshraghi A, Kim J, Walls AC, Ledvina HE, Miller CN, Ramsey KM, Whitney JC, Radey MC, Peterson SB, Ruhland BR, Tran BQ, Goo YA, Goodlett DR, Dove SL, Celli J, Veesler D, Mougous JD (2016). Secreted Effectors Encoded within and outside of the Francisella Pathogenicity Island Promote Intramacrophage Growth. Cell Host Microbe. 20(5):573-583. [PudMed:27832588] experimental
 
experimental experimental literature