SecReT6
Effector Protein ID: 118497902
iglC
SecReT6 ID158
T6SS typeB
Gene symboliglC
Locus tagFTN_1322
StrainFrancisella novicida U112
Repliconchromosome [GenBank: NC_008601] [Browse all T6SS(s) in this replicon]
Location [Strand]1396989..1397618 [-]
Productintracellular growth locus protein C
Effector typeProtein
Homologous effectorFTN_1322
DescriptioniglC
UniProt IDA0Q7I3
KEGG IDftn:FTN_1322
PDB IDNA
Domain hit(s) vs Pfam IglC [PF11550], Evalue: 1.10E-141, Aligned region: 1..209
Protein Sequence: 209 a.a.     [Download]
>gi|118497902|ref|YP_898952.1| intracellular growth locus protein C [Francisella novicida U112]
MSEMITRQQVTSGETIHVRTDPTACIGSHPNCRLFIDSLTIAGEKLDKNIVAIEGGEDVTKADSATAAAS
VIRLSITPGSINPTISITLGVLIKSNVRTKIEEKVSSILQASATDMKIKLGNSNKKQEYKTDEAWGIMID
LSNLELYPISAKAFSISIEPTELMGVSKDGMSYHIISIDGLTTSQGSLPVCCAASTDKGVAKIGYIAAA
-
Nucleotide Sequence: 630 bp     [Download]
>gi|118496615|ref|NC_008601.1|:c1397618-1396989 Francisella novicida U112 chromosome, complete genome
ATGAGTGAGATGATAACAAGACAACAGGTAACAAGTGGCGAGACCATTCATGTGAGAACTGATCCTACTG
CATGTATAGGATCTCATCCTAATTGTAGATTATTTATTGATTCTTTAACTATAGCTGGGGAGAAACTTGA
TAAAAATATCGTTGCTATAGAGGGTGGAGAGGATGTCACGAAAGCTGATTCGGCTACAGCTGCTGCTAGT
GTAATACGTTTATCTATAACGCCAGGCTCTATAAATCCAACAATAAGTATTACTCTTGGTGTTCTAATTA
AATCAAATGTCAGAACTAAAATTGAAGAGAAAGTTTCGAGCATATTACAAGCAAGTGCTACAGATATGAA
AATTAAGTTAGGTAATTCTAATAAAAAACAAGAGTACAAAACTGATGAAGCATGGGGTATTATGATAGAT
CTATCTAATTTAGAGTTATATCCAATAAGTGCTAAGGCTTTTAGTATTAGTATAGAGCCAACAGAACTTA
TGGGTGTTTCAAAAGATGGAATGAGTTATCATATTATATCTATAGATGGTCTTACAACATCTCAAGGAAG
CTTGCCAGTATGTTGCGCAGCTAGCACAGATAAAGGAGTTGCTAAAATAGGATATATTGCAGCTGCATAG

Reference
(1) Eshraghi A, Kim J, Walls AC, Ledvina HE, Miller CN, Ramsey KM, Whitney JC, Radey MC, Peterson SB, Ruhland BR, Tran BQ, Goo YA, Goodlett DR, Dove SL, Celli J, Veesler D, Mougous JD (2016). Secreted Effectors Encoded within and outside of the Francisella Pathogenicity Island Promote Intramacrophage Growth. Cell Host Microbe. 20(5):573-583. [PudMed:27832588] experimental
 
experimental experimental literature