SecReT6
Effector Protein ID: 118497905
pdpD
SecReT6 ID158
T6SS typeB
Gene symbolpdpD
Locus tagFTN_1325
StrainFrancisella novicida U112
Repliconchromosome [GenBank: NC_008601] [Browse all T6SS(s) in this replicon]
Location [Strand]1399803..1403540 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorFTN_1325
DescriptionpdpD
UniProt IDA0Q7I6, Q7X3J6
KEGG IDftn:FTN_1325
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1245 a.a.     [Download]
>gi|118497905|ref|YP_898955.1| hypothetical protein FTN_1325 [Francisella novicida U112]
MDQDINDLLYDTDDLKKEKVNGGFFDFIKAWFYNDVERHMFFEDEIIVAQKLKTMDVMANTYALERKKYF
EKFLKDSHKQKGFFTRIKDRDFAFYKDPTRVKLWSSITDTDVYSFFIKSSVNQMLGGGNIAQLTSLPKFK
FNAIASVNSENISAAASLAATGEKSFLGSSCINVWSNLPVFDSERGDVKSFIPLYLRMSGKASSALFNYN
IDIGASTNKLKFTESKCMELLNNFKGNVNLRLVAAKSSREARSFIYTPKFKEDSNKHLNDLGFILNAQQG
SYRYLVPETRDGLDLIREYTYPEIEQIYFGRSALSGYSKSNYDKQSLGIEKNGEGLMTLRVSSKDYENPL
IQVKTSVNVTSFDLLSGEIKGKILADDLIGFSDAKGAINKFRNEVDTIIKNNISESFKSPFKIPNLSEFS
DMEIRVRFGLYSKQSASKLRTIRISIPMTTKMLDFNQTSGSYNTKPGMGYSMAQRHQLKEAIPYNEGLLE
NSAQRLFSGENLDFKNQLRSIAKDLTKDYVDFGNYAKDKANSLMENISNAAQQDFDLVKPTGNSTLGAVQ
DNLSNIYDKSSTFDSVIGSLRELYKLKGEDLTNIDSNDILNVLSQNSSLAELSGSVGADLNELKSKFKDI
ASIDIKKKASEAILSTSYQQYNPSFNKAKIFDNPDSFYVQDTLINYSQTLKKEQFRDQMSTINIIEFGSD
SDLPILFNLCKMMTSESAKADAKDFLSHKENASKTKEFIDALENTTSVISPESNISYTSINVLCSKNAGG
VITENNKASSVSLGSTISLADFNRMYSLDSRVSMLGVSPLEELSSFSAKKNEYKITFEEYFTKLVIQRYM
EVIMIDDEADFIKSFVSPMMECQKKLLDNLVILNKDAKWKSSSSFKSTFSSGSSFSFTGWLKERLPGFDF
ELSQEYAYFTGLVINFSIEEDNSSSETVIKLCKIIKSLDGLVRGFYFLLRRMVKNRNTKVGSHNVSESHI
NMVKQILTSLCEPYQILTQKVSDNAELLSALVNMLSFMDSLVEVQRLCASICIPTSAFFTLVNENKNLLK
DICYTVEKSGVTGIVVESTFSYSPELFKENQQDIKLNIKNTSVRVRNGKVKRVSSIDRNANTEAILQSIY
DNIIAFDEQDLERLFTGFRILKQENSTNTNKAVFNIGLTYHPITNNAFVEFNKDQQSLLYSYNNLSKDAY
VTKIKSIVDAKVALNLSFEHEEIRSSQGFSVLATVPARGYSIDDLNRKYRPMIWV
-
Nucleotide Sequence: 3738 bp     [Download]
>gi|118496615|ref|NC_008601.1|:c1403540-1399803 Francisella novicida U112 chromosome, complete genome
ATGGATCAAGATATCAACGATTTATTATATGATACTGATGACCTCAAAAAAGAAAAAGTAAATGGAGGAT
TTTTTGATTTTATCAAAGCTTGGTTTTATAATGACGTTGAAAGACATATGTTTTTTGAAGATGAGATTAT
TGTAGCTCAGAAACTTAAAACGATGGATGTCATGGCTAATACATACGCCTTAGAAAGAAAAAAATATTTT
GAAAAATTTCTCAAAGATTCTCATAAACAAAAAGGTTTTTTTACAAGAATAAAAGATAGGGATTTTGCTT
TTTATAAAGATCCTACTAGGGTTAAACTATGGAGTAGTATTACTGATACGGATGTTTATAGCTTTTTTAT
AAAGTCAAGCGTTAATCAGATGCTTGGTGGTGGTAATATAGCTCAACTGACATCATTGCCAAAATTTAAG
TTTAATGCAATAGCATCAGTTAATAGTGAAAACATCTCTGCAGCAGCTAGTCTTGCAGCTACTGGAGAAA
AAAGTTTTTTGGGAAGTTCATGTATAAATGTTTGGTCTAATTTACCTGTATTTGATAGTGAAAGAGGAGA
TGTTAAATCATTTATTCCATTATACCTAAGAATGAGTGGTAAAGCTTCATCGGCATTATTTAATTATAAT
ATAGATATAGGTGCTAGCACAAATAAATTAAAATTTACTGAATCAAAATGCATGGAATTGTTAAATAACT
TTAAGGGTAATGTAAATCTTAGATTAGTAGCTGCAAAAAGCTCTAGAGAAGCAAGAAGCTTTATTTATAC
TCCAAAATTTAAAGAAGATAGTAATAAGCATTTAAATGATTTAGGTTTTATTCTAAATGCTCAGCAAGGT
TCATATAGATATTTAGTTCCTGAAACTAGGGATGGACTTGATCTAATTAGAGAATATACATACCCCGAAA
TTGAACAGATTTATTTTGGTAGGAGTGCACTTTCTGGTTATTCAAAAAGTAATTATGACAAGCAAAGTTT
AGGTATTGAGAAAAATGGTGAGGGTCTTATGACTCTTAGGGTTAGTTCCAAAGATTATGAAAATCCACTA
ATTCAGGTCAAAACTTCAGTTAATGTAACTAGTTTTGATCTTTTATCAGGAGAAATAAAAGGTAAGATTT
TAGCTGATGACTTAATTGGTTTTTCAGATGCTAAAGGTGCTATTAATAAGTTCAGAAACGAAGTTGATAC
AATTATTAAAAACAATATTAGTGAAAGCTTTAAGTCTCCTTTTAAGATACCAAACTTATCTGAATTTAGT
GATATGGAGATAAGAGTGAGGTTTGGTTTATATTCTAAACAATCAGCATCCAAGTTGAGGACCATAAGAA
TCTCTATTCCTATGACTACTAAAATGTTAGATTTTAATCAAACATCTGGGTCATATAATACAAAACCAGG
TATGGGTTATTCAATGGCTCAGAGACATCAATTAAAAGAAGCAATACCTTATAATGAAGGTCTTCTAGAA
AATTCTGCTCAGAGATTGTTTAGTGGTGAAAACTTAGATTTTAAAAACCAGTTGAGATCTATAGCTAAAG
ATCTGACGAAAGATTATGTCGATTTTGGTAATTATGCAAAAGATAAGGCTAACTCTTTGATGGAGAATAT
TTCAAATGCTGCTCAGCAGGATTTTGATTTGGTTAAACCAACCGGAAATAGTACTCTTGGAGCTGTGCAA
GATAATTTATCAAACATATATGATAAAAGTAGTACGTTTGACTCAGTAATAGGTTCTTTGAGAGAGCTTT
ATAAACTTAAAGGTGAAGACCTAACGAATATTGATTCTAATGATATCCTTAATGTTTTATCACAAAATTC
TTCTTTAGCAGAGTTATCTGGTAGTGTTGGGGCAGATCTAAATGAGCTAAAGTCTAAGTTTAAGGATATC
GCATCTATAGATATAAAGAAAAAAGCATCTGAAGCAATATTATCTACAAGTTATCAGCAATATAACCCTA
GTTTTAATAAGGCAAAAATATTCGATAACCCAGATTCTTTCTATGTTCAAGATACTTTAATTAACTACTC
ACAAACTCTAAAAAAAGAACAATTTAGAGATCAGATGTCGACAATAAATATTATTGAGTTTGGTAGTGAT
AGTGACTTACCTATATTATTTAATCTTTGTAAAATGATGACTAGTGAGTCAGCAAAAGCTGATGCTAAAG
ATTTTCTAAGCCACAAGGAAAATGCTAGTAAAACTAAAGAATTTATTGATGCTTTAGAAAATACCACTTC
TGTAATAAGTCCAGAATCAAATATCAGTTATACATCTATTAATGTGCTTTGTAGCAAAAATGCTGGAGGT
GTAATTACTGAGAATAACAAAGCATCTTCTGTATCCCTAGGTTCAACTATTAGTTTAGCGGATTTTAATA
GAATGTATTCGCTTGACTCAAGAGTTTCTATGCTTGGAGTATCTCCTTTAGAAGAGTTATCAAGTTTTTC
AGCGAAAAAAAATGAATATAAAATCACTTTTGAAGAATATTTTACTAAGTTAGTGATTCAAAGATATATG
GAAGTTATTATGATAGATGATGAAGCTGACTTTATAAAATCATTTGTATCACCAATGATGGAGTGTCAAA
AGAAACTATTAGATAATTTAGTTATTCTAAATAAGGATGCTAAATGGAAAAGTAGTTCATCATTTAAGAG
CACTTTCTCAAGTGGTAGTAGTTTTAGTTTTACTGGTTGGCTTAAAGAGAGACTTCCTGGCTTTGATTTT
GAACTTTCTCAGGAGTATGCTTATTTTACTGGTTTAGTAATAAACTTTTCAATTGAAGAAGATAATTCTT
CTTCTGAAACCGTAATTAAGCTATGTAAAATTATAAAATCTTTAGATGGGCTTGTTAGAGGTTTTTATTT
CTTACTAAGAAGGATGGTGAAAAATAGAAATACTAAAGTTGGTTCTCATAATGTCTCTGAAAGTCACATT
AATATGGTTAAGCAGATTTTAACATCCTTATGTGAACCATATCAGATTTTAACTCAGAAGGTAAGCGATA
ATGCTGAACTGTTGTCTGCTTTAGTTAATATGTTGAGTTTTATGGATAGCCTTGTTGAAGTACAGCGGTT
ATGTGCTTCGATTTGTATTCCAACCAGTGCATTTTTCACTTTAGTGAATGAAAATAAAAATTTGTTGAAA
GATATTTGCTACACTGTCGAAAAAAGTGGTGTTACAGGAATAGTGGTTGAATCGACATTTAGCTATTCGC
CAGAACTCTTCAAAGAAAATCAACAAGATATTAAGCTTAACATTAAAAACACGTCAGTCAGAGTACGAAA
TGGTAAAGTCAAGAGGGTTAGCAGCATTGATAGGAATGCTAATACTGAAGCTATCTTACAAAGTATTTAT
GATAATATAATTGCGTTTGATGAACAAGATTTAGAAAGACTATTTACGGGGTTTAGGATTTTAAAACAAG
AAAATTCGACAAACACTAATAAAGCCGTTTTCAATATTGGTTTAACATATCATCCAATAACTAATAATGC
TTTTGTTGAATTTAATAAGGATCAACAAAGTTTATTGTACTCATATAATAATTTAAGCAAAGATGCGTAT
GTCACAAAAATTAAAAGTATAGTTGATGCTAAAGTTGCTTTAAACCTTAGTTTTGAACATGAAGAGATTA
GAAGTTCACAAGGTTTTAGTGTCTTAGCAACTGTACCAGCTAGAGGATATTCTATAGATGATTTAAATAG
AAAGTATAGACCAATGATCTGGGTTTAA

Reference
(1) Eshraghi A, Kim J, Walls AC, Ledvina HE, Miller CN, Ramsey KM, Whitney JC, Radey MC, Peterson SB, Ruhland BR, Tran BQ, Goo YA, Goodlett DR, Dove SL, Celli J, Veesler D, Mougous JD (2016). Secreted Effectors Encoded within and outside of the Francisella Pathogenicity Island Promote Intramacrophage Growth. Cell Host Microbe. 20(5):573-583. [PudMed:27832588] experimental
 
experimental experimental literature