SecReT6
Effector Protein ID: 119900186
SecReT6 ID161
T6SS typeA3
Gene symbolsciM
Locus tagazo3897
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]4275148..4275636 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA0085
DescriptionHcp protein
UniProt IDA1KCF7
KEGG IDazo:azo3897
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.20E-43, Aligned region: 6..136
Protein Sequence: 162 a.a.     [Download]
>gi|119900186|ref|YP_935399.1| hypothetical protein azo3897 [Azoarcus sp. BH72]
MAVDMFIKIGDIKGESVDKVHADKIDVLAWSWGMSQSGTTHMGSGGGSGKVSVQDISFTKYVDASSHALI
MACCNGKHYDEAVLIVRKAGEKPLEYIKVTMKEVIVTSVSTGGSGGEDRLTENVTLNFAEFKYEYTKQAP
KGGKDSTMTATWNIAENDGNVG
-
Nucleotide Sequence: 489 bp     [Download]
>gi|119896292|ref|NC_008702.1|:4275148-4275636 Azoarcus sp. BH72 chromosome, complete genome
ATGGCAGTTGATATGTTCATCAAGATCGGCGACATCAAGGGTGAGTCGGTCGACAAGGTGCACGCCGACA
AGATCGACGTGCTCGCCTGGAGCTGGGGCATGAGCCAGTCCGGCACCACCCACATGGGCAGCGGCGGCGG
CTCCGGCAAGGTCAGCGTGCAGGACATCTCCTTCACCAAGTACGTGGACGCCTCCAGCCACGCGCTGATC
ATGGCCTGCTGCAACGGCAAGCACTACGACGAAGCCGTGCTGATCGTGCGCAAGGCCGGCGAGAAACCGC
TCGAGTACATCAAGGTCACGATGAAGGAAGTCATCGTCACCTCCGTCAGCACCGGCGGCAGCGGTGGTGA
GGATCGCCTGACCGAGAACGTCACGCTGAACTTCGCCGAGTTCAAGTACGAGTACACCAAGCAGGCGCCG
AAGGGTGGCAAGGACAGCACCATGACCGCGACCTGGAACATCGCCGAAAACGACGGCAACGTCGGCTGA