SecReT6
Effector Protein ID: 120610188
-
SecReT6 ID164
T6SS typeA3
Gene symbol-
Locus tagAave_1502
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T6SS(s) in this replicon]
Location [Strand]1666961..1667398 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I0068
DescriptionTae2
UniProt IDA1TMA4
KEGG IDaav:Aave_1502
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 145 a.a.     [Download]
>gi|120610188|ref|YP_969866.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MPYVSLNYKNNSAAPVGKWTCAPTSNLQPFGEVPPTNKTGGPNFCGQCVSYVKKVCPSLPGTTQWRKGAQ
VKDNQSIAPGTAIATFNASGHYEGHAAIYVSQDAAGIKVYDQYVTPPSPKAVGPRVLRWGAHGNSNNGNN
FYVIE
-
Nucleotide Sequence: 438 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c1667398-1666961 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGCCCTATGTATCTTTAAACTACAAAAACAACTCGGCAGCACCCGTAGGAAAGTGGACATGCGCCCCGA
CGTCGAATCTTCAGCCGTTTGGAGAAGTTCCACCGACCAACAAGACCGGGGGACCGAATTTCTGTGGCCA
GTGCGTCTCTTACGTCAAAAAGGTTTGTCCATCTCTGCCAGGCACCACCCAATGGCGCAAAGGTGCTCAA
GTCAAAGACAATCAAAGCATAGCGCCCGGCACCGCCATCGCCACATTCAATGCCTCGGGCCACTATGAAG
GCCACGCAGCCATCTACGTGAGCCAGGATGCCGCCGGCATCAAGGTATACGATCAATACGTTACTCCGCC
AAGCCCTAAAGCTGTCGGCCCAAGAGTTCTCCGATGGGGCGCCCATGGCAACTCAAACAATGGGAACAAC
TTTTATGTCATTGAGTAA