SecReT6
Effector Protein ID: 124381616
-
SecReT6 ID172
T6SS typeA1
Gene symbol-
Locus tagBMA10229_0722
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]761865..764888 [+]
ProductRhs element Vgr protein
Effector typeProtein
Homologous effectorBMAA0737
Descriptiontype VI secretion system Vgr family protein
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.20E-67, Aligned region: 46..349
Phage_base_V [PF04717], Evalue: 3.00E-16, Aligned region: 396..489
Protein Sequence: 1007 a.a.     [Download]
>gi|124381616|ref|YP_001024537.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MPSSPRHDAPASRANAAPSANARRFTFASDAYDPATFDVVDINGRDAISQPYRFEITLVSRQLRIDFAKM
LSRGATLAILPPFGEAGTTRYAGVLAEFEQKKRFRDFTVYRATLVPRLWRLSLYKASDVYLNEQTIPDIV
KRVLRAASFGSRDFRMRHGGGYRKRSFVCQYDESHLDFVSRWMEKEGLYYYFEHDGRHETLVIVDDRRHQ
PGPADDLALRYLPATSLDAGIEADRVQAFTCRATPLPREVVLRDFNHRKAELSLEVRERVARDGVGERVS
SDEHFHTKDEGQRYAKLRAEALVCEGRRFAGESTAAGLRAGRFFALSGHYREDFDGRYLVTALTHRGSQA
HLLFPDLDAPFGATPGEPIYRAEFEAIAADLQYRPPRTTPKPRAAGVVSAIVDGEGGGKLAELDEYGQYK
VRFPFAHTAHPANKASARIRMATPYAGDDRGMHLPLLKRTEVKIAFDGGDPDRPVIVGAVPNSSHRSVVT
RRNPAEHRILTEHNQLYMKDGSGAATWLHAPNNHIGIGAVGPGDGLALLTSGNKFDFSLGNAYSFSGGLK
CSVSMGGNTDVYVGVRNSLDVSANFLTTLQGNLRWMLPGSRSFEINDSASTLLQTLHKQSATGAIRLSAG
QDASALLQKQLDKLKGTVRKFMIVSGLANAGSAAAAAGLIKGGGKLADLPWAGFGISAAQFAGVTGVSTA
LMATSRTLLANVAKLQEALPLVADLSLGKQGIALAAKNLTHATRMSLTVDGVSWSTHAKGPGAAGAAMSV
GKGRWGVEAAKHAHVHASDTLLFAVPADPTTQFDLKDLIGLRRDLDECMKDIADLEADISENEVLSTDQN
TFGVSALIPTPPSPAGALAAVAIKVKQAKLVELKAKQKLVALKVDNLQQKFAKHVQHLSAVRMSASDAQL
GFKGNRLVATADGVTLAHAQGKAKLDVREAKIGVTAGKSSVELDEGKIAAGCGSASLKLGSDGAIDVSAT
DVKLNGTNVKLNGSASLKFDGQLIQLG
-
Nucleotide Sequence: 3024 bp     [Download]
>gi|124381141|ref|NC_008835.1|:761865-764888 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGCCTTCGTCCCCCCGCCACGATGCGCCCGCGTCGCGCGCGAACGCCGCGCCGTCCGCGAACGCGCGAC
GCTTCACGTTCGCGAGCGACGCGTACGACCCCGCGACATTCGACGTCGTCGACATCAACGGCCGCGACGC
GATCTCGCAGCCGTACCGGTTCGAGATCACGCTCGTGAGCAGGCAGTTGCGGATCGACTTCGCGAAGATG
CTGAGCCGCGGGGCGACGCTCGCGATCCTGCCGCCGTTCGGCGAGGCCGGCACCACCCGCTATGCCGGCG
TGCTCGCCGAATTCGAGCAGAAGAAACGCTTTCGCGACTTCACCGTCTATCGCGCGACGCTCGTGCCGCG
CCTCTGGCGACTATCGCTGTACAAGGCGTCGGACGTCTATCTGAACGAGCAGACGATTCCCGACATCGTC
AAGCGCGTGCTGCGCGCCGCCTCGTTCGGCAGCCGCGATTTCCGCATGCGGCACGGCGGCGGCTACCGCA
AGCGCAGCTTCGTCTGCCAATACGACGAGAGCCATCTCGATTTCGTGTCGCGCTGGATGGAGAAGGAAGG
CCTCTACTACTACTTCGAGCATGACGGCCGGCACGAAACGCTCGTGATCGTCGACGACCGCCGCCATCAG
CCCGGCCCCGCCGACGATCTCGCGCTGCGCTACCTACCCGCGACCAGCCTCGACGCGGGCATCGAAGCGG
ACCGCGTGCAGGCGTTCACATGCCGGGCGACGCCGCTGCCGCGCGAAGTCGTGCTGCGCGACTTCAACCA
CCGCAAGGCGGAGCTCTCGCTCGAAGTCCGCGAGCGCGTGGCGCGCGACGGCGTCGGCGAGCGGGTGTCG
AGCGACGAGCACTTCCACACGAAGGACGAAGGGCAGCGCTACGCGAAGCTGCGCGCCGAGGCGCTCGTCT
GCGAAGGGCGCCGATTCGCCGGCGAATCGACCGCGGCCGGGCTGCGCGCCGGCCGCTTCTTCGCGCTGTC
GGGCCACTACCGCGAGGATTTCGACGGCCGCTATCTGGTGACGGCGCTCACGCATCGCGGCTCGCAGGCA
CACCTGCTGTTTCCCGATCTCGACGCGCCGTTCGGCGCGACGCCGGGCGAGCCCATCTACCGCGCCGAGT
TCGAGGCGATTGCCGCCGACCTCCAGTACCGGCCGCCGCGCACGACGCCCAAGCCGCGCGCGGCGGGCGT
CGTCAGCGCGATCGTCGACGGCGAGGGCGGCGGCAAGCTCGCCGAGCTCGACGAATACGGCCAGTACAAG
GTGCGCTTTCCGTTCGCGCACACCGCGCATCCGGCGAACAAGGCCTCCGCGCGCATCCGGATGGCGACGC
CCTACGCGGGCGACGACCGCGGCATGCACCTGCCGCTGCTGAAGCGCACCGAAGTGAAGATCGCATTCGA
CGGCGGCGATCCGGACCGCCCCGTGATCGTCGGCGCGGTGCCCAACTCGTCGCACCGCAGCGTCGTCACG
CGCCGCAACCCCGCCGAGCATCGCATCCTCACCGAGCACAACCAGCTCTACATGAAGGACGGCAGCGGCG
CGGCGACGTGGCTGCACGCGCCGAACAACCACATCGGCATCGGCGCGGTCGGGCCGGGCGACGGCCTCGC
GCTCCTCACGTCCGGCAACAAGTTCGACTTCTCGCTCGGCAACGCGTACAGCTTCTCGGGCGGGCTCAAG
TGCTCGGTGTCGATGGGCGGCAACACCGACGTCTACGTCGGCGTGCGCAACAGCCTCGACGTCAGCGCGA
ACTTCCTGACGACGCTGCAGGGCAACCTGCGCTGGATGCTGCCCGGCAGCCGGAGCTTCGAGATCAACGA
CAGCGCATCGACACTGCTGCAGACGCTGCACAAGCAGTCCGCGACGGGCGCGATCCGGCTGTCCGCCGGG
CAGGACGCGTCCGCGCTGCTGCAAAAGCAGCTCGACAAGCTCAAGGGCACGGTGCGCAAGTTCATGATCG
TGTCGGGCCTCGCGAACGCCGGGTCCGCGGCCGCCGCCGCGGGGCTCATCAAGGGCGGCGGCAAGCTCGC
CGATCTGCCGTGGGCGGGCTTCGGCATATCCGCCGCGCAGTTCGCCGGCGTGACCGGCGTCAGCACGGCG
CTGATGGCGACCTCGCGCACGCTGCTCGCGAACGTCGCGAAGCTCCAGGAGGCGTTGCCGCTCGTCGCCG
ATCTGTCGCTCGGCAAGCAGGGCATCGCGCTCGCCGCGAAGAACCTCACGCACGCGACGCGGATGTCGCT
CACCGTCGACGGCGTCTCGTGGTCGACGCACGCGAAGGGGCCCGGCGCGGCGGGCGCCGCGATGAGCGTC
GGCAAGGGCCGCTGGGGCGTCGAAGCGGCGAAGCACGCGCACGTCCACGCGAGCGACACGCTGCTGTTCG
CGGTGCCGGCCGACCCGACGACCCAGTTCGACCTGAAGGACCTGATCGGGCTGCGCCGCGATCTCGACGA
ATGCATGAAGGACATCGCCGATCTCGAAGCCGACATTTCGGAAAACGAAGTGCTGTCGACCGATCAGAAC
ACGTTCGGCGTCAGCGCGCTCATCCCCACGCCGCCGTCGCCCGCCGGCGCGCTCGCGGCGGTCGCGATCA
AGGTGAAGCAAGCGAAGCTCGTCGAGCTGAAGGCCAAGCAGAAGCTCGTCGCGCTGAAGGTCGACAACCT
GCAGCAGAAGTTCGCGAAGCACGTGCAGCACCTGAGCGCCGTGCGGATGAGCGCTTCCGACGCGCAGCTC
GGCTTCAAGGGCAACCGGCTCGTCGCGACGGCCGACGGCGTCACGCTCGCGCATGCGCAGGGCAAGGCGA
AGCTCGACGTGCGCGAAGCGAAGATCGGCGTCACGGCGGGCAAATCGAGCGTCGAGCTCGACGAAGGCAA
GATCGCGGCCGGCTGCGGCAGCGCATCGCTGAAGCTCGGCAGCGACGGCGCGATCGACGTGAGCGCGACC
GACGTCAAGCTGAACGGCACCAACGTCAAGCTGAACGGCAGCGCGTCGCTGAAGTTCGACGGCCAACTGA
TCCAGCTCGGCTGA