SecReT6
Effector Protein ID: 124382870
-
SecReT6 ID172
T6SS typeA1
Gene symbol-
Locus tagBMA10229_0717
StrainBurkholderia mallei NCTC 10229
Repliconchromosome II [GenBank: NC_008835] [Browse all T6SS(s) in this replicon]
Location [Strand]755016..755525 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBMAA0742
DescriptionHcp protein
UniProt IDA2RXW3
KEGG IDbml:BMA10229_0717
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.50E-24, Aligned region: 6..155
Protein Sequence: 169 a.a.     [Download]
>gi|124382870|ref|YP_001024532.1| unnamed protein product [Burkholderia mallei NCTC 10229]
MLAGIYLKVKGKTQGEIKGSVVQEGHDGKIHILAFKNDYDMPARLQEGLTPAAAARGTITLTKEMDRSSP
QFLQALGKREMMEEFEITIHRPKTDTTGGDLTELLFTYKFEKVLITHMDQYSPTPHKDDSNGIKEGLLGY
IEEIKFAYSGYSLEHAESGIAGAANWTNG
-
Nucleotide Sequence: 510 bp     [Download]
>gi|124381141|ref|NC_008835.1|:755016-755525 Burkholderia mallei NCTC 10229 chromosome II, complete sequence
ATGCTGGCCGGAATATATCTCAAGGTCAAAGGAAAAACCCAGGGGGAAATCAAAGGCTCCGTCGTTCAGG
AAGGTCATGACGGGAAGATCCACATCCTCGCCTTCAAGAACGACTACGACATGCCCGCCAGGCTCCAGGA
AGGCCTGACGCCCGCCGCCGCCGCTCGCGGCACGATCACGTTGACGAAGGAAATGGACAGATCGTCGCCG
CAATTCCTGCAGGCGCTCGGCAAGCGCGAGATGATGGAAGAGTTCGAGATCACGATCCACCGTCCGAAGA
CGGATACAACAGGTGGGGACCTGACCGAACTCCTGTTCACGTACAAGTTCGAAAAAGTGCTGATCACCCA
CATGGACCAATACTCGCCCACGCCGCACAAAGACGATAGCAACGGCATCAAGGAAGGCTTGCTCGGCTAT
ATCGAGGAGATCAAGTTCGCGTATTCGGGATACTCGTTGGAACATGCGGAATCGGGCATCGCGGGCGCCG
CAAACTGGACGAATGGCTGA