SecReT6
Effector Protein ID: 126439768
-
SecReT6 ID178
T6SS typeA4b
Gene symbol-
Locus tagBURPS668_0080
StrainBurkholderia pseudomallei 668
Repliconchromosome I [GenBank: NC_009074] [Browse all T6SS(s) in this replicon]
Location [Strand]75977..76417 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I0068
DescriptionTae2
UniProt IDA3N464
KEGG IDbpd:BURPS668_0080
PDB IDNA
Domain hit(s) vs Pfam CHAP [PF05257], Evalue: 0.0043, Aligned region: 45..123
Protein Sequence: 146 a.a.     [Download]
>gi|126439768|ref|YP_001057135.1| hypothetical protein BURPS668_0080 [Burkholderia pseudomallei 668]
MPYVSTHYSNNASAPVGRWTCAPTSKLAPFDKAPTGSVTSGVDLCGQCVSYVKRVCPTLPLTGQWRKGAP
VKGNATIVAGTVIATFNAAGKYDGHAAIYVSQTKDGGILVYDQFVTPPTPQPVQQRRLRWGAHGRSNNGD
NFYVVE
-
Nucleotide Sequence: 441 bp     [Download]
>gi|126438353|ref|NC_009074.1|:75977-76417 Burkholderia pseudomallei 668 chromosome I, complete sequence
ATGCCTTACGTGTCGACCCATTACTCGAACAACGCCAGCGCGCCGGTCGGCCGCTGGACCTGCGCGCCGA
CTTCGAAGCTCGCGCCTTTCGACAAGGCGCCGACGGGCAGCGTCACGTCCGGCGTCGATCTGTGCGGCCA
ATGCGTGTCCTACGTGAAACGGGTCTGCCCGACGCTGCCGCTCACCGGGCAATGGCGCAAGGGCGCGCCG
GTGAAAGGCAACGCGACGATCGTCGCGGGCACCGTGATCGCGACGTTCAACGCCGCCGGCAAGTACGACG
GCCACGCGGCGATCTACGTCAGCCAGACGAAGGACGGCGGCATCCTGGTGTACGACCAGTTCGTGACGCC
GCCGACGCCGCAGCCGGTTCAGCAACGGCGCCTGCGCTGGGGCGCGCATGGTCGGTCGAACAATGGGGAT
AACTTCTATGTCGTGGAGTAA