SecReT6
Effector Protein ID: 126441542
-
SecReT6 ID178
T6SS typeA4b
Gene symbol-
Locus tagBURPS668_1584
StrainBurkholderia pseudomallei 668
Repliconchromosome I [GenBank: NC_009074] [Browse all T6SS(s) in this replicon]
Location [Strand]1549545..1551854 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I2698
DescriptionTle1
UniProt IDA3N8F4
KEGG IDbpd:BURPS668_1584
PDB IDNA
Domain hit(s) vs Pfam DUF2235 [PF09994], Evalue: 2.70E-55, Aligned region: 9..104
DUF2235 [PF09994], Evalue: 2.70E-55, Aligned region: 227..248
DUF2235 [PF09994], Evalue: 2.70E-55, Aligned region: 252..376
Protein Sequence: 769 a.a.     [Download]
>gi|126441542|ref|YP_001058625.1| hypothetical protein BURPS668_1584 [Burkholderia pseudomallei 668]
MACCKTLHIGIFFDGTRNNADRDRGARKESNVARLYAAFPIDKYHQAIYVAGVGTPFVEQIGDFGVGLQA
AAGAAAGWAGEGRINWALLRIHDILHAYVHGQTLTAVLGKRYEELVKSMSLDMNFKGIDLGGTPPKPGSF
GDIKLRANSGVGALKLIAAEQNGVELTWDLDTNWAQLKNELDSSKWNAAVQEWDAKRRKVLLDRRAQLKA
RIGDLLVKGKPKLQRIRLYVFGFSRGAAEARTFSNWLADALDPDFSLCGVPVSYDFLGIFDTVASVGIAQ
SAAATLFDGHGGWGRKELMAVPHYVRRCVHMVAAHEPRGSFPLDLIDCSMDGREEIVYPGVHSDVGGGYG
PGEQGRGRDDADKLSQVPLLDMYREARKAGVPLDINGPGIGADVIAAFKVSAGLKQAFAAYVKKSENYYY
EKDHGTPGLMRCHYGLYLRWRKMRLKDMHAQPSFKAAQARYPQDAADLDSANAELKEEWNDLLEVEKAGG
PTITRYVEKFVTKWASENPKTAAVVSTSLLPAAVAAEVFVPGVSAATVLFGDKVVKLVQAQLKEKWEQWL
QVRSDWNMGPPEPAISALYDNYMHDSRAWFKPLGDDDDVWNHRQIQELKTKQASFERAHAAWKKRVEMGM
PSPLQVTQAMGVGSTGWGPVGGLPPEPEPRSPLTAQQADLLKRYDAAMQSAKQARAAKDPNAPTDSAVLT
DPKVTGGLALQTSGREFYFLWGFLRWRTVFVNGVRWDQPRVPTVQEEMEGMRMQMQRQVDMKGIGVLFQ
-
Nucleotide Sequence: 2310 bp     [Download]
>gi|126438353|ref|NC_009074.1|:1549545-1551854 Burkholderia pseudomallei 668 chromosome I, complete sequence
ATGGCTTGTTGTAAGACATTGCATATCGGAATTTTCTTTGATGGTACGCGTAACAACGCTGATCGGGATA
GGGGGGCGCGAAAGGAAAGCAATGTGGCACGGCTTTATGCCGCTTTTCCAATCGATAAATATCACCAAGC
GATTTACGTTGCTGGAGTTGGCACGCCTTTTGTCGAGCAGATTGGTGATTTCGGTGTTGGCTTACAGGCG
GCCGCAGGAGCTGCGGCAGGTTGGGCGGGAGAGGGGCGAATTAACTGGGCGTTGCTTCGGATTCACGATA
TTTTGCATGCGTATGTTCACGGTCAGACGTTAACGGCAGTGTTAGGAAAGCGCTACGAGGAACTCGTAAA
ATCGATGAGCCTCGATATGAATTTTAAGGGCATCGACCTTGGCGGAACGCCGCCTAAACCGGGAAGCTTC
GGCGATATCAAATTGCGTGCCAATTCTGGTGTGGGGGCGCTCAAGCTGATTGCTGCCGAACAGAATGGTG
TCGAGCTGACTTGGGATTTAGATACGAATTGGGCGCAGCTCAAAAACGAGTTGGATTCGTCGAAGTGGAA
TGCAGCCGTGCAAGAATGGGACGCCAAGCGCCGCAAGGTATTGCTCGATCGTCGTGCTCAGCTAAAAGCG
CGCATTGGTGATCTGCTGGTCAAGGGGAAGCCGAAGCTGCAACGCATTCGGCTATACGTATTCGGTTTTT
CGCGCGGCGCAGCGGAGGCTCGCACTTTCTCGAACTGGCTTGCTGACGCGCTTGACCCCGATTTCAGTTT
GTGTGGAGTGCCGGTTTCATACGATTTTCTCGGCATCTTTGATACGGTCGCATCGGTCGGCATCGCTCAG
AGCGCCGCCGCAACATTATTCGACGGACATGGAGGATGGGGGCGCAAGGAACTGATGGCCGTGCCGCATT
ATGTGCGCCGTTGCGTGCACATGGTGGCGGCACATGAACCGCGTGGATCATTTCCGCTCGACCTTATCGA
TTGTTCGATGGACGGTCGTGAGGAGATTGTCTACCCGGGTGTTCACTCGGACGTCGGCGGCGGCTATGGG
CCGGGCGAACAGGGGCGCGGTCGGGACGACGCCGACAAACTTTCGCAAGTCCCGCTGCTTGATATGTACC
GGGAGGCGCGTAAGGCAGGTGTGCCCTTGGATATCAATGGGCCGGGTATCGGCGCGGACGTCATCGCTGC
ATTCAAGGTTTCAGCAGGGCTAAAACAAGCCTTCGCAGCCTACGTAAAAAAGAGCGAGAACTATTATTAC
GAGAAAGATCACGGCACGCCGGGCCTAATGCGTTGCCATTACGGCTTGTATCTCCGGTGGCGCAAGATGC
GGCTCAAGGACATGCATGCACAGCCCAGCTTCAAGGCTGCGCAGGCGCGCTATCCGCAAGATGCAGCGGA
TCTGGACAGTGCGAACGCGGAATTGAAGGAGGAGTGGAACGATTTGCTGGAGGTCGAGAAAGCTGGCGGC
CCGACAATCACCCGATACGTGGAGAAGTTTGTTACGAAATGGGCCAGTGAGAATCCGAAAACGGCCGCCG
TCGTTTCCACGTCTCTACTTCCGGCCGCGGTCGCTGCTGAGGTTTTTGTTCCGGGGGTTAGCGCTGCGAC
GGTTCTATTCGGCGACAAAGTAGTGAAACTGGTGCAAGCCCAACTCAAGGAGAAGTGGGAGCAGTGGCTG
CAAGTTCGCAGCGACTGGAACATGGGGCCGCCTGAACCTGCGATCAGCGCACTCTACGACAACTACATGC
ACGACTCCCGCGCATGGTTCAAGCCGCTCGGCGACGATGACGACGTGTGGAACCATAGGCAGATTCAGGA
ACTCAAGACCAAGCAAGCCAGCTTTGAACGCGCCCATGCTGCCTGGAAAAAGCGTGTCGAAATGGGCATG
CCAAGCCCGTTGCAGGTTACACAGGCAATGGGCGTAGGTTCCACAGGATGGGGGCCCGTCGGCGGGCTTC
CGCCCGAACCCGAACCCCGCTCCCCGCTCACCGCCCAGCAAGCCGATCTGCTCAAGCGCTACGACGCCGC
GATGCAGTCCGCCAAGCAGGCACGCGCCGCAAAGGACCCGAACGCGCCGACGGACAGCGCCGTGCTGACC
GATCCGAAGGTGACGGGCGGCCTCGCGCTGCAAACCAGCGGCCGCGAGTTCTATTTCCTGTGGGGCTTCC
TGCGCTGGCGGACCGTGTTCGTGAACGGCGTGCGCTGGGACCAGCCGCGCGTGCCGACGGTGCAGGAGGA
AATGGAGGGCATGCGCATGCAGATGCAACGCCAGGTCGATATGAAGGGCATCGGCGTACTGTTCCAATGA