SecReT6
Effector Protein ID: 126443193
-
SecReT6 ID182
T6SS typeA1
Gene symbol-
Locus tagBURPS668_A2142
StrainBurkholderia pseudomallei 668
Repliconchromosome II [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]2082514..2083911 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBMAA0729
Descriptionputative deubiquitinase
UniProt IDA3NLB4
KEGG IDbpd:BURPS668_A2142
PDB IDNA
Domain hit(s) vs Pfam Big_5 [PF13205], Evalue: 1.50E-09, Aligned region: 170..265
UCH [PF00443], Evalue: 9.40E-08, Aligned region: 274..306
UCH [PF00443], Evalue: 9.40E-08, Aligned region: 415..447
DUF4088 [PF13317], Evalue: 0.0078, Aligned region: 318..378
Protein Sequence: 465 a.a.     [Download]
>gi|126443193|ref|YP_001063135.1| hypothetical protein BURPS668_A2142 [Burkholderia pseudomallei 668]
MNARRPAFGLIASHASRRRAVESVRAHFPFMFTLCLAMKPTSNHSDPSGAPSSARRAASDSSRLVRGMRS
PQRGGAALALAVASLAGCGGGDSGEPAPREFAPPTVQLAYPTQPNSPVAPAPTAHVSSGHTPPATAPAAM
PTASPTATAAASPSAPSTATPNAPPAAPLAVVATRVPPTHAALRRPTIELEFDRAIEPGSVPHIVLRADD
GTSVAVGPLSWLSDRRIAFAPRKPLKSNSRYEIMVPAGIRSTTGERSAHPLTSGFDTAPVTPPRGLPNLD
GASCFINTALQLAVHSSALDDILSNEAVPPAVRTLLEDYDAASADALDAQLAAAVAALRAMPEVTDSGAG
RTLEVMHALRMPLYDASSANNATNNADAIRHAPPNTKAFFLNSYPPLSYADLPNHDRLVAFDYSTGGHYV
AYVKRDGIWYRIDDAQVSAVNEQDLLALPAFNPDGSVSIEIAIYR
-
Nucleotide Sequence: 1398 bp     [Download]
>gi|126442307|ref|NC_009075.1|:2082514-2083911 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGAACGCTCGACGTCCGGCGTTCGGCCTGATTGCGTCGCACGCGTCACGCCGCCGGGCCGTCGAATCCG
TGCGCGCCCACTTTCCGTTCATGTTCACCCTCTGTCTTGCGATGAAACCCACTTCGAACCACTCCGACCC
TTCCGGTGCGCCGTCGTCAGCGCGGCGCGCCGCATCCGATTCGTCCCGCCTCGTCCGCGGCATGCGCTCG
CCCCAACGCGGCGGCGCGGCACTGGCGCTGGCCGTCGCCTCGCTCGCCGGATGCGGGGGCGGCGATTCGG
GCGAACCCGCTCCACGCGAATTCGCGCCCCCGACAGTGCAACTCGCCTACCCGACGCAACCGAACTCGCC
CGTCGCACCAGCGCCCACCGCGCACGTATCGAGCGGACACACGCCTCCGGCCACGGCGCCCGCCGCGATG
CCCACCGCTTCACCCACCGCGACGGCTGCCGCTTCGCCCTCCGCGCCATCCACTGCGACGCCCAACGCCC
CGCCCGCCGCTCCGCTGGCCGTCGTCGCCACCCGCGTCCCGCCGACGCACGCGGCGTTGCGCCGCCCGAC
GATCGAACTCGAATTCGATCGCGCGATCGAGCCGGGTTCAGTCCCACACATCGTGCTGCGCGCCGACGAT
GGCACGAGCGTCGCCGTCGGCCCGTTGTCGTGGCTGAGCGATCGCCGGATCGCGTTCGCGCCGCGCAAGC
CGCTCAAGTCGAACAGCCGCTACGAAATCATGGTGCCCGCCGGCATCAGGAGCACCACGGGCGAACGGTC
GGCCCATCCGCTAACGAGCGGCTTCGATACCGCGCCCGTCACGCCGCCGCGCGGCCTGCCCAATCTCGAC
GGCGCCTCGTGCTTCATCAACACGGCGCTGCAATTGGCGGTTCACTCGTCGGCGCTCGACGACATTCTGT
CGAACGAAGCCGTCCCGCCCGCCGTCCGCACGCTGCTCGAAGACTACGACGCCGCATCGGCTGACGCGCT
CGACGCGCAGTTGGCCGCCGCGGTCGCCGCGCTGCGCGCCATGCCGGAGGTCACGGACAGTGGGGCGGGA
CGAACGCTGGAAGTGATGCACGCGTTGCGGATGCCGCTATACGACGCGAGCAGCGCGAACAACGCAACGA
ACAACGCCGACGCCATACGTCATGCGCCGCCCAACACCAAGGCGTTCTTTCTGAACTCCTATCCACCGCT
TTCCTACGCGGATCTGCCGAACCACGACCGGCTCGTCGCGTTCGACTACAGCACGGGCGGTCACTATGTC
GCTTATGTGAAGCGGGATGGAATCTGGTATCGAATCGACGATGCCCAGGTCAGCGCCGTCAACGAACAGG
ACTTGCTTGCCCTGCCGGCGTTCAACCCCGACGGCAGCGTGTCGATCGAAATCGCGATCTATCGATGA