SecReT6
Effector Protein ID: 126444360
-
SecReT6 ID178
T6SS typeA4b
Gene symbol-
Locus tagBURPS668_A1695
StrainBurkholderia pseudomallei 668
Repliconchromosome I [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]1646115..1647458 [-]
ProductType V secretory pathway, adhesin AidA
Effector typeProtein
Homologous effectorBTH_II0090
Description
UniProt IDA3NK19
KEGG IDbpd:BURPS668_A1695
PDB IDNA
Domain hit(s) vs Pfam DUF3274 [PF11678], Evalue: 5.30E-121, Aligned region: 117..426
Protein Sequence: 447 a.a.     [Download]
>gi|126444360|ref|YP_001062690.1| Type V secretory pathway, adhesin AidA [Burkholderia pseudomallei 668]
MVERFRFHRLILRDHTRQRDSAVTSEPHTIPELAELMIDSAHSCGRAGQNWSKTQGKRPDKGGKHWITFD
ERDNRGKVYLYFCPEDTVVGLDKVRGIGTFGVPDEVPADGAAASRGKTMPAMTVLEPKRFFQRMWTRLER
DQDGRGKRSKVAVGTPPARVPVRDPFQRLTPGPDTDGTMLGTLVESGKNMALQASFKRNDIRFINGEQLK
PAYEPDLYGGEVRKGGQVPGHADVAGLMRPDDVTKNVALGNQYAKFKWKDVATTGDPGAGIEPHKQAFNR
GRPVDEQSHNWRIVPSRSLGSMLSAAATGGRYQTYVIQREETPDEVRKRMRTDADQLEANNYHSGVLLSS
ENHRWVTAMDVAIGQAVTLDDPDWRQLLLLMADWKMTPDVYRNIQKCKNFERLDEHTREFVKACVDYYKT
GRFPDEKYVPLTMPPLVTSELKVESKT
-
Nucleotide Sequence: 1344 bp     [Download]
>gi|126442307|ref|NC_009075.1|:c1647458-1646115 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
GTGGTAGAGCGCTTTCGGTTTCATCGCCTCATCTTACGCGACCACACCCGCCAACGTGACAGCGCCGTGA
CGAGCGAGCCGCATACGATTCCGGAGCTGGCCGAACTGATGATCGATTCGGCCCATTCGTGCGGCCGGGC
CGGACAGAACTGGAGCAAGACGCAGGGAAAGCGGCCGGACAAGGGCGGCAAGCACTGGATCACGTTCGAC
GAGCGCGACAACCGCGGCAAGGTCTATCTGTACTTTTGCCCGGAAGATACCGTGGTCGGCCTCGACAAGG
TGCGGGGGATCGGCACGTTCGGCGTGCCCGACGAGGTGCCGGCCGATGGCGCGGCGGCCAGCCGGGGCAA
AACGATGCCCGCGATGACGGTGCTTGAGCCGAAGCGCTTCTTTCAGCGCATGTGGACGCGGCTCGAGCGC
GACCAGGACGGCAGGGGGAAGCGCTCGAAGGTCGCCGTCGGCACGCCGCCCGCGCGCGTGCCGGTTCGCG
ACCCGTTTCAGCGATTGACGCCGGGCCCCGACACGGACGGCACGATGCTTGGCACCTTGGTCGAATCCGG
CAAGAACATGGCGCTGCAGGCATCGTTCAAGCGCAACGACATTCGCTTCATCAACGGCGAGCAACTGAAA
CCGGCGTACGAGCCCGATCTGTACGGGGGCGAGGTTCGGAAGGGCGGACAGGTGCCCGGGCACGCCGATG
TCGCCGGGTTGATGCGTCCGGACGACGTGACGAAAAACGTCGCGCTCGGCAACCAGTACGCGAAGTTCAA
ATGGAAAGACGTCGCGACGACGGGCGATCCGGGCGCCGGCATCGAGCCGCACAAGCAGGCGTTCAATCGC
GGGCGTCCGGTCGACGAGCAGTCGCATAACTGGCGCATCGTGCCGAGCCGGTCGCTCGGCTCGATGCTGT
CGGCGGCCGCCACGGGCGGACGGTATCAGACGTACGTGATCCAGCGCGAGGAGACGCCGGACGAGGTTCG
CAAGCGCATGCGCACCGATGCCGATCAACTGGAAGCGAACAACTATCATTCGGGCGTGCTGCTCAGTTCG
GAGAACCATCGCTGGGTCACGGCGATGGACGTGGCGATCGGTCAGGCGGTGACGCTGGATGATCCGGACT
GGCGGCAGTTGTTGCTTTTGATGGCGGATTGGAAGATGACGCCGGACGTGTATCGCAATATCCAGAAATG
CAAGAACTTTGAGCGCTTGGACGAACACACGCGCGAATTCGTGAAAGCGTGTGTCGATTACTACAAGACG
GGCCGATTTCCCGACGAGAAGTATGTACCTCTCACCATGCCACCGCTCGTGACCAGCGAACTGAAGGTTG
AGAGCAAAACATGA