SecReT6
Effector Protein ID: 126444367
-
SecReT6 ID178
T6SS typeA4b
Gene symbol-
Locus tagBURPS668_A2913
StrainBurkholderia pseudomallei 668
Repliconchromosome I [GenBank: NC_009075] [Browse all T6SS(s) in this replicon]
Location [Strand]2765611..2766516 [+]
Productouter membrane protein
Effector typeProtein
Homologous effectorBTH_II0310
Description
UniProt IDA3NNI3
KEGG IDbpd:BURPS668_A2913
PDB IDNA
Domain hit(s) vs Pfam B_lectin [PF01453], Evalue: 8.90E-11, Aligned region: 87..134
B_lectin [PF01453], Evalue: 8.90E-11, Aligned region: 190..229
Protein Sequence: 301 a.a.     [Download]
>gi|126444367|ref|YP_001063904.1| outer membrane protein [Burkholderia pseudomallei 668]
MKKYALALWFMLVSSMSAMAGAIIPSGATLVAGQYAISNNGNFAFGVDAASGKLYFHYRFPTQAWGASAM
SQMYGTQPEGALYVGKGDRLVMQTDGRLVFYSGNDVVWSNWYYGPAPIPGSYAVVEDFGVVAIYPPQGGY
PTFTWPFASVTPNSGALATVVGYPFGVNFPVLNGRQWLQIFNNVTYYLWNKSFAADSVAMQTDGNLVVYN
KGQPVWSTGTSGNPGAYMLVTPVGFVLGKQYGGILANVPYPVSVDQSSRASGPNDPKPTPAAPPPPSLNL
PINASWKCYYVKDWLACYAPG
-
Nucleotide Sequence: 906 bp     [Download]
>gi|126442307|ref|NC_009075.1|:2765611-2766516 Burkholderia pseudomallei 668 chromosome chromosome II, complete sequence
ATGAAAAAATACGCATTGGCGCTCTGGTTCATGCTGGTTTCATCAATGTCGGCAATGGCAGGGGCGATCA
TTCCATCGGGCGCAACGCTGGTTGCGGGGCAATACGCGATATCGAACAACGGCAACTTCGCATTCGGCGT
CGACGCCGCCAGCGGCAAGCTCTATTTCCACTACAGGTTCCCGACGCAGGCGTGGGGCGCGAGCGCGATG
TCGCAAATGTACGGAACGCAGCCCGAGGGCGCGCTCTACGTCGGCAAGGGCGACCGGCTCGTGATGCAGA
CCGACGGGCGGCTCGTGTTCTATTCGGGCAACGACGTCGTCTGGAGCAACTGGTATTACGGCCCCGCGCC
GATCCCCGGCTCGTATGCGGTCGTCGAGGATTTCGGCGTCGTCGCGATCTATCCGCCGCAGGGCGGCTAT
CCGACGTTCACCTGGCCGTTCGCGTCGGTCACGCCGAACAGCGGCGCGCTCGCGACGGTGGTCGGCTATC
CGTTCGGCGTGAACTTCCCGGTGCTCAACGGGCGCCAATGGCTGCAGATCTTCAACAACGTCACTTACTA
CCTGTGGAACAAGAGCTTCGCCGCGGACAGCGTCGCGATGCAGACCGACGGCAATCTCGTCGTCTACAAC
AAGGGGCAGCCGGTCTGGTCGACGGGAACGTCGGGCAATCCGGGCGCCTATATGCTGGTGACGCCTGTCG
GCTTTGTGCTCGGCAAGCAGTACGGCGGCATCCTCGCGAACGTGCCCTACCCGGTGTCCGTCGATCAGTC
GAGCCGCGCGAGCGGCCCGAACGATCCGAAGCCGACGCCGGCCGCGCCGCCGCCGCCCTCGCTGAACCTG
CCGATCAATGCGAGCTGGAAGTGCTATTACGTGAAGGACTGGCTCGCGTGCTACGCGCCGGGTTGA