SecReT6
Effector Protein ID: 126446753
SecReT6 ID191
T6SS typeA1
Gene symbol-
Locus tagBMA10247_A1675
StrainBurkholderia mallei NCTC 10247
Repliconchromosome II [GenBank: NC_009079] [Browse all T6SS(s) in this replicon]
Location [Strand]1612696..1613205 [+]
Producthcp protein
Effector typeProtein
Homologous effectorBMAA0742
DescriptionHcp protein
UniProt IDA3MF22
KEGG IDbmn:BMA10247_A1675
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.50E-24, Aligned region: 6..155
Protein Sequence: 169 a.a.     [Download]
>gi|126446753|ref|YP_001078858.1| hcp protein [Burkholderia mallei NCTC 10247]
MLAGIYLKVKGKTQGEIKGSVVQEGHDGKIHILAFKNDYDMPARLQEGLTPAAAARGTITLTKEMDRSSP
QFLQALGKREMMEEFEITIHRPKTDTTGGDLTELLFTYKFEKVLITHMDQYSPTPHKDDSNGIKEGLLGY
IEEIKFAYSGYSLEHAESGIAGAANWTNG
-
Nucleotide Sequence: 510 bp     [Download]
>gi|126445587|ref|NC_009079.1|:1612696-1613205 Burkholderia mallei NCTC 10247 chromosome II, complete sequence
ATGCTGGCCGGAATATATCTCAAGGTCAAAGGAAAAACCCAGGGGGAAATCAAAGGCTCCGTCGTTCAGG
AAGGTCATGACGGGAAGATCCACATCCTCGCCTTCAAGAACGACTACGACATGCCCGCCAGGCTCCAGGA
AGGCCTGACGCCCGCCGCCGCCGCTCGCGGCACGATCACGTTGACGAAGGAAATGGACAGATCGTCGCCG
CAATTCCTGCAGGCGCTCGGCAAGCGCGAGATGATGGAAGAGTTCGAGATCACGATCCACCGTCCGAAGA
CGGATACAACAGGTGGGGACCTGACCGAACTCCTGTTCACGTACAAGTTCGAAAAAGTGCTGATCACCCA
CATGGACCAATACTCGCCCACGCCGCACAAAGACGATAGCAACGGCATCAAGGAAGGCTTGCTCGGCTAT
ATCGAGGAGATCAAGTTCGCGTATTCGGGATACTCGTTGGAACATGCGGAATCGGGCATCGCGGGCGCCG
CAAACTGGACGAATGGCTGA