SecReT6
Effector Protein ID: 126451804
-
SecReT6 ID184
T6SS typeA4b
Gene symbol-
Locus tagBURPS1106A_3658
StrainBurkholderia pseudomallei 1106a
Repliconchromosome I [GenBank: NC_009076] [Browse all T6SS(s) in this replicon]
Location [Strand]3561181..3561684 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorBCAL0343
DescriptionHcp protein
UniProt IDA3NZW8
KEGG IDbpl:BURPS1106A_3658
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.40E-45, Aligned region: 6..139
Protein Sequence: 167 a.a.     [Download]
>gi|126451804|ref|YP_001067889.1| hypothetical protein BURPS1106A_3658 [Burkholderia pseudomallei 1106a]
MLHMHLKFGSPAIKGESADKDHEGWIELKSWDHSIVQPRSATASTAGGHTATRCEHGDMVFTKEIDSSSP
LLYQHASGGTTFDEVTIDFLRADGEGQRVKYLEIKLKYVIISSIAPSVHTEGLPVETFSLKYAAVQWKQT
QQKIGGNQGGNTQGAWSLTKNDKTYAV
-
Nucleotide Sequence: 504 bp     [Download]
>gi|126451443|ref|NC_009076.1|:c3561684-3561181 Burkholderia pseudomallei 1106a chromosome I, complete sequence
ATGTTACACATGCATTTGAAGTTCGGTAGTCCCGCCATCAAGGGCGAGTCCGCTGACAAGGACCACGAAG
GCTGGATCGAGCTGAAATCCTGGGATCACTCGATCGTTCAGCCGCGTTCGGCGACCGCGTCGACGGCGGG
CGGCCACACGGCGACGCGTTGCGAGCACGGCGACATGGTGTTCACGAAGGAAATCGATTCGTCGAGCCCG
CTGCTGTATCAGCACGCGTCGGGCGGCACCACGTTCGACGAAGTGACGATCGATTTCCTGCGCGCGGACG
GCGAAGGCCAGCGCGTGAAGTATCTCGAGATCAAGCTGAAGTACGTGATCATCTCGAGCATCGCGCCGAG
CGTGCATACCGAAGGCCTGCCGGTCGAGACCTTCTCGCTGAAGTACGCCGCGGTCCAGTGGAAGCAGACG
CAGCAGAAGATCGGCGGCAACCAGGGCGGCAACACGCAGGGCGCCTGGAGCCTCACGAAGAACGACAAGA
CCTACGCGGTCTAA