SecReT6
Effector Protein ID: 126451896
-
SecReT6 ID184
T6SS typeA4b
Gene symbol-
Locus tagBURPS1106A_1609
StrainBurkholderia pseudomallei 1106a
Repliconchromosome I [GenBank: NC_009076] [Browse all T6SS(s) in this replicon]
Location [Strand]1560574..1562883 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I2698
DescriptionTle1
UniProt IDA3NU59
KEGG IDbpl:BURPS1106A_1609
PDB IDNA
Domain hit(s) vs Pfam DUF2235 [PF09994], Evalue: 3.00E-55, Aligned region: 9..104
DUF2235 [PF09994], Evalue: 3.00E-55, Aligned region: 227..248
DUF2235 [PF09994], Evalue: 3.00E-55, Aligned region: 252..376
Protein Sequence: 769 a.a.     [Download]
>gi|126451896|ref|YP_001065880.1| hypothetical protein BURPS1106A_1609 [Burkholderia pseudomallei 1106a]
MACCKTLHIGIFFDGTRNNADRDRGARTESNVARLYAAFPIDKYHQAIYVAGVGTPFVEQIGDFGVGLQA
AAGAAAGWAGEGRINWALLRIHDILHAYVHGQTLTAVLGKRYEELVKSMSLDMNFKGIDLGGTPPKPGSF
GDIKLRANSGVGALKLIAAEQNGVELTWDLDTNWAQLKNELDSSKWNAAVQEWDAKRRKVLLDRRAQLKA
RIGDLLVKGKPKLQRIRLYVFGFSRGAAEARTFSNWLADALDPDFSLCGVPVSYDFLGIFDTVASVGIAQ
SAAATLFDGHGGWGRKELMAVPHYVRRCVHMVAAHEPRGSFPLDLIDCSMDGREEIVYPGVHSDVGGGYG
PGEQGRGRDDADKLSQVPLLDMYREARKAGVPLDINGPGIGADVIAAFKVSAGLKQAFAAYVKKSENYYY
EKDHGTPGLMRCHYGLYLRWRKMRLKDMHAQPSFKAAQARYPQDAADLDSANAELKEEWNDLLEVEKAGG
PTITRYVEKFVTKWASENPKTAAVVSTSLLPAAVAAEVFVPGVSAATVLFGDKVVKLVQAQLKEKWEQWL
QVRSDWNMGPPEPAISALYDNYMHDSRAWFKPLGDDDDVWNHRQIQELKTKQASFERAHAAWKKRVEMGM
PSLLQVTQAMGVGSTGWGPVGGLPPEPEPRSPLTAQQADLLKRYDAAMQSAKQARAAKDPNAPTDSAVLT
DPKVTGGLALQTSGREFYFLWGFLRWRTVFVNGVRWDQPRVPTVQEEMEGMRMQMQRQVDMKGIGVLFQ
-
Nucleotide Sequence: 2310 bp     [Download]
>gi|126451443|ref|NC_009076.1|:1560574-1562883 Burkholderia pseudomallei 1106a chromosome I, complete sequence
ATGGCTTGTTGTAAGACATTGCATATCGGAATCTTCTTTGATGGTACGCGTAACAACGCTGATCGGGATA
GGGGGGCGCGAACGGAAAGCAATGTGGCACGGCTTTATGCCGCTTTTCCAATAGATAAATATCACCAAGC
GATTTACGTTGCTGGAGTTGGCACGCCTTTTGTCGAGCAGATTGGTGATTTCGGTGTTGGCTTACAGGCG
GCCGCAGGAGCTGCGGCAGGTTGGGCGGGAGAGGGGCGAATTAACTGGGCTTTGCTTCGGATTCACGATA
TTTTGCATGCGTATGTTCACGGTCAGACGTTAACGGCAGTGTTAGGAAAGCGCTACGAGGAACTCGTAAA
ATCGATGAGCCTCGATATGAATTTTAAGGGCATCGACCTTGGCGGAACGCCGCCTAAACCGGGAAGCTTC
GGCGATATCAAATTGCGTGCCAATTCTGGTGTGGGGGCGCTCAAGCTGATTGCTGCCGAACAGAATGGTG
TCGAGCTGACTTGGGATTTAGATACGAATTGGGCGCAGCTCAAAAACGAGTTGGATTCGTCGAAGTGGAA
TGCAGCCGTGCAAGAATGGGACGCCAAGCGCCGTAAGGTATTGCTCGATCGTCGTGCTCAGCTAAAAGCG
CGCATCGGTGATCTGCTGGTCAAGGGGAAGCCGAAGCTGCAACGCATTCGGCTATACGTATTCGGCTTTT
CGCGCGGTGCAGCGGAGGCTCGCACTTTCTCGAACTGGCTTGCTGACGCGCTTGACCCCGATTTCAGTTT
GTGTGGAGTGCCGGTTTCATACGATTTTCTCGGTATCTTTGATACGGTCGCATCGGTCGGCATCGCTCAG
AGCGCCGCCGCAACATTATTCGACGGACATGGAGGATGGGGGCGCAAGGAACTGATGGCCGTGCCGCATT
ATGTGCGCCGTTGCGTGCACATGGTGGCGGCACATGAACCTCGTGGATCATTTCCGCTCGACCTTATCGA
TTGTTCGATGGACGGTCGTGAGGAGATTGTCTACCCGGGTGTTCACTCGGACGTCGGCGGCGGCTATGGG
CCGGGCGAACAGGGGCGCGGTCGGGACGACGCCGACAAACTTTCGCAAGTCCCGCTGCTTGATATGTACC
GGGAGGCGCGTAAGGCAGGTGTGCCCTTGGATATCAATGGGCCAGGTATCGGCGCGGACGTCATCGCTGC
ATTCAAGGTTTCAGCAGGGCTAAAACAAGCCTTCGCAGCCTACGTAAAAAAGAGCGAGAACTATTATTAC
GAGAAAGATCACGGCACGCCGGGCCTAATGCGTTGCCATTACGGCTTGTATCTCCGGTGGCGCAAGATGC
GGCTCAAGGACATGCATGCACAGCCCAGCTTCAAGGCTGCGCAGGCGCGCTATCCGCAAGATGCAGCGGA
TCTGGACAGTGCGAACGCGGAATTGAAGGAGGAGTGGAACGATTTGCTGGAGGTCGAGAAAGCTGGCGGC
CCGACAATCACCCGATACGTGGAGAAGTTTGTTACGAAATGGGCCAGTGAGAATCCGAAAACGGCCGCCG
TCGTTTCCACGTCTCTACTTCCGGCCGCGGTCGCTGCTGAGGTTTTTGTTCCGGGGGTTAGCGCTGCGAC
GGTTCTATTCGGCGACAAAGTGGTGAAACTGGTGCAAGCCCAACTCAAGGAGAAGTGGGAGCAGTGGCTG
CAAGTTCGCAGCGACTGGAACATGGGGCCGCCTGAACCTGCGATCAGCGCACTCTACGACAACTACATGC
ACGACTCCCGCGCATGGTTCAAGCCGCTCGGCGACGATGACGACGTGTGGAACCATAGGCAGATTCAGGA
ACTCAAGACCAAGCAAGCCAGCTTTGAACGCGCCCATGCTGCCTGGAAAAAGCGTGTCGAAATGGGCATG
CCAAGCTTGTTGCAGGTTACACAGGCAATGGGCGTAGGTTCCACAGGATGGGGGCCCGTCGGCGGGCTTC
CGCCCGAACCCGAACCCCGCTCCCCGCTCACCGCCCAGCAAGCCGATCTGCTCAAGCGCTACGACGCCGC
GATGCAGTCCGCCAAGCAGGCACGCGCCGCAAAGGACCCGAACGCGCCGACGGACAGCGCCGTGCTGACC
GATCCGAAGGTGACGGGCGGCCTCGCGCTGCAAACCAGCGGCCGCGAGTTCTATTTCCTGTGGGGCTTCC
TGCGCTGGCGGACCGTGTTCGTGAACGGCGTGCGCTGGGACCAGCCGCGCGTGCCGACGGTGCAGGAGGA
AATGGAGGGCATGCGCATGCAGATGCAACGCCAGGTCGACATGAAGGGCATCGGCGTACTGTTCCAATGA