SecReT6
Effector Protein ID: 126452333
-
SecReT6 ID184
T6SS typeA4b
Gene symbol-
Locus tagBURPS1106A_0079
StrainBurkholderia pseudomallei 1106a
Repliconchromosome I [GenBank: NC_009076] [Browse all T6SS(s) in this replicon]
Location [Strand]75535..76503 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I0068
DescriptionTae2
UniProt IDA3NPU3
KEGG IDbpl:BURPS1106A_0079
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 322 a.a.     [Download]
>gi|126452333|ref|YP_001064364.1| hypothetical protein BURPS1106A_0079 [Burkholderia pseudomallei 1106a]
MRMCGRPAYVAPPGVIDWRGRAMPRVCERAGAQRVNERARGGIPCAIFRVRSCMRDSGEQERAAHAMSDR
RAGQGAAAQTACASRAFGVFRVRVRDRLVSAYIERGCRCRRASRRPCAARMHTPARPMRARRANCTRRGI
CVELSRRLIVSRICPTIRFAWLVAAIRIPLIKTEGTMPYVSTHYSNNASAPVGRWTCAPTSKLAPFDKAP
TGSVTSGVDLCGQCVSYVKRVCPTLPLTGQWRKGAPVKGNATIVAGTVIATFNAAGKYDGHAAIYVSQTK
DGGILVYDQFVTPPTPQPVRQRRLRWGAHGRSNNGDNFYVVE
-
Nucleotide Sequence: 969 bp     [Download]
>gi|126451443|ref|NC_009076.1|:75535-76503 Burkholderia pseudomallei 1106a chromosome I, complete sequence
ATGCGGATGTGCGGTCGGCCCGCCTACGTCGCGCCGCCCGGCGTGATCGATTGGCGCGGGCGCGCGATGC
CTCGCGTTTGCGAACGCGCCGGCGCTCAACGGGTAAACGAACGAGCGCGCGGCGGTATTCCGTGCGCGAT
ATTCCGCGTGCGCTCTTGCATGCGCGACAGCGGCGAGCAGGAACGCGCGGCGCACGCGATGAGCGACCGG
CGCGCCGGGCAAGGCGCGGCTGCGCAAACGGCATGCGCGTCGCGCGCCTTCGGTGTTTTTCGTGTTCGTG
TCCGCGATCGGCTTGTGTCCGCGTACATTGAGCGCGGATGCCGTTGCCGTCGCGCATCGCGGCGGCCGTG
CGCGGCGCGCATGCATACGCCGGCACGGCCGATGCGCGCGCGACGCGCAAACTGCACGCGGCGCGGGATT
TGTGTTGAATTGTCGCGGCGGTTGATCGTTTCGCGCATCTGCCCGACAATCCGGTTCGCTTGGCTGGTTG
CGGCAATTCGAATTCCGCTTATAAAAACCGAGGGAACCATGCCTTACGTGTCGACCCATTACTCGAACAA
CGCCAGCGCGCCGGTCGGCCGCTGGACCTGCGCGCCGACTTCGAAGCTCGCGCCTTTCGACAAGGCGCCG
ACGGGCAGCGTCACGTCCGGCGTCGATCTGTGCGGCCAATGCGTGTCCTACGTGAAACGGGTCTGCCCGA
CGCTGCCGCTCACCGGGCAATGGCGCAAGGGCGCGCCGGTGAAAGGCAACGCGACGATCGTCGCGGGCAC
CGTGATCGCGACGTTCAACGCCGCCGGCAAGTACGACGGCCACGCGGCGATCTACGTCAGCCAGACGAAG
GACGGCGGCATCCTGGTGTACGACCAGTTCGTGACGCCGCCGACGCCGCAGCCGGTTCGGCAACGGCGCC
TGCGCTGGGGCGCGCATGGTCGGTCGAACAATGGGGATAACTTCTATGTCGTGGAGTAA