SecReT6
Effector Protein ID: 126457376
-
SecReT6 ID188
T6SS typeA1
Gene symbol-
Locus tagBURPS1106A_A2027
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]1995159..1995668 [+]
Producthcp protein
Effector typeProtein
Homologous effectorBMAA0742
DescriptionHcp protein
UniProt IDA3P6V0
KEGG IDbpl:BURPS1106A_A2027
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-24, Aligned region: 6..155
Protein Sequence: 169 a.a.     [Download]
>gi|126457376|ref|YP_001076060.1| hcp protein [Burkholderia pseudomallei 1106a]
MLAGIYLKVKGKTQGEIKGSVVQEGHDGKIHILAFKNDYDMPARLQEGLTPAAAARGTITLTKEMDRSSP
QFLQALGKREMMEEFEITIHRPKTDTTGGDLTELLFTYKFEKVLITHMDQYSPTPHKDDSNGIKEGLLGY
IEEIKFTYSGYSLEHAESGIAGAANWTNG
-
Nucleotide Sequence: 510 bp     [Download]
>gi|126455463|ref|NC_009078.1|:1995159-1995668 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGCTGGCCGGAATATATCTCAAGGTCAAAGGAAAAACCCAGGGGGAAATCAAAGGCTCCGTCGTTCAGG
AAGGTCATGACGGGAAAATCCACATCCTCGCCTTCAAGAACGACTACGACATGCCTGCCAGGCTCCAGGA
AGGCCTGACGCCCGCCGCCGCCGCTCGCGGCACGATCACGTTGACGAAGGAAATGGACAGATCGTCGCCG
CAATTCCTGCAGGCGCTCGGCAAGCGCGAGATGATGGAAGAGTTCGAGATCACGATCCACCGTCCGAAGA
CGGATACAACAGGTGGGGACCTGACCGAACTCCTGTTCACGTACAAGTTCGAAAAAGTGCTGATCACCCA
CATGGACCAATACTCGCCCACGCCGCACAAAGACGATAGCAACGGCATCAAGGAAGGCTTGCTCGGCTAT
ATCGAGGAGATCAAGTTCACGTATTCGGGATACTCGTTGGAACACGCGGAATCGGGCATCGCGGGCGCCG
CAAACTGGACGAATGGCTGA