SecReT6
Effector Protein ID: 126457393
-
SecReT6 ID188
T6SS typeA1
Gene symbol-
Locus tagBURPS1106A_A2045
StrainBurkholderia pseudomallei 1106a
Repliconchromosome II [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]2017927..2018781 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBMAA0729
Descriptionputative deubiquitinase
UniProt IDA3P6W7
KEGG IDbpl:BURPS1106A_A2045
PDB IDNA
Domain hit(s) vs Pfam Big_5 [PF13205], Evalue: 4.50E-09, Aligned region: 5..85
Big_5 [PF13205], Evalue: 4.50E-09, Aligned region: 268..278
UCH [PF00443], Evalue: 2.10E-08, Aligned region: 92..124
UCH [PF00443], Evalue: 2.10E-08, Aligned region: 233..265
Peptidase_C98 [PF15499], Evalue: 0.0062, Aligned region: 101..150
Peptidase_C98 [PF15499], Evalue: 0.0062, Aligned region: 231..268
Protein Sequence: 284 a.a.     [Download]
>gi|126457393|ref|YP_001076077.1| hypothetical protein BURPS1106A_A2045 [Burkholderia pseudomallei 1106a]
MRRPTIELEFDRAIEPGSVPHIALRADDGTSVAVGPLSWLSDRRIAFAPRKPLKSNSRYEIMVPAGIRST
TGERSAHPLTSSFDTAPVTPPRGLPNLDGASCFINTALQLAVHSSALDDILSNEAVPPAVRTLLEDYDAA
SADALDAQLAAAVAALRATPEVPDSGPGQTLEVMQALRMPLYDTSSANNATNNADAIRHAPPNTKAFFLN
SYPPLSYADLPNHDRLVAFDYSTGGHYVAYVKRDGIWYRIDDAQVSAVNEQDLLALPAFNPANGSVSIEI
AIYR
-
Nucleotide Sequence: 855 bp     [Download]
>gi|126455463|ref|NC_009078.1|:2017927-2018781 Burkholderia pseudomallei 1106a chromosome II, complete sequence
TTGCGCCGCCCGACGATCGAACTCGAATTCGATCGCGCGATCGAGCCGGGTTCAGTCCCACACATCGCGC
TGCGCGCCGACGATGGCACGAGCGTCGCCGTCGGCCCGTTGTCGTGGCTGAGCGATCGCCGGATCGCGTT
CGCGCCGCGCAAACCGCTCAAGTCGAACAGCCGCTACGAAATCATGGTGCCCGCCGGCATCAGGAGCACC
ACGGGCGAACGGTCGGCTCATCCGCTAACGAGCAGCTTCGATACCGCGCCCGTCACGCCGCCGCGCGGCC
TGCCCAATCTCGACGGCGCCTCGTGCTTCATCAACACGGCGCTGCAATTGGCGGTTCACTCGTCGGCGCT
CGACGACATTCTGTCGAACGAAGCCGTCCCGCCCGCCGTCCGCACGCTGCTCGAAGACTACGACGCCGCA
TCGGCTGACGCACTCGACGCGCAGTTGGCCGCCGCGGTCGCCGCGCTGCGCGCCACGCCGGAGGTCCCGG
ACAGCGGGCCGGGACAAACGCTGGAAGTGATGCAAGCGTTGCGGATGCCGTTATATGACACGAGCAGCGC
GAACAACGCAACGAACAACGCCGACGCCATACGTCATGCGCCGCCCAACACCAAGGCGTTCTTTCTGAAC
TCCTATCCACCGCTTTCCTACGCGGATCTGCCGAACCACGACCGGCTCGTCGCGTTCGACTACAGCACGG
GCGGTCACTATGTCGCTTATGTGAAGCGGGATGGAATCTGGTATCGAATCGACGATGCCCAGGTCAGCGC
CGTCAACGAACAGGACTTGCTTGCCCTGCCGGCGTTCAACCCCGCTAACGGCAGCGTGTCGATCGAAATC
GCGATCTATCGATGA