SecReT6
Effector Protein ID: 126457559
-
SecReT6 ID184
T6SS typeA4b
Gene symbol-
Locus tagBURPS1106A_A0101
StrainBurkholderia pseudomallei 1106a
Repliconchromosome I [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]91141..93381 [+]
ProductType V secretory pathway, adhesin AidA
Effector typeProtein
Homologous effectorBTH_II0090
Description
UniProt IDA3P1D4
KEGG IDbpl:BURPS1106A_A0101
PDB IDNA
Domain hit(s) vs Pfam DUF3274 [PF11678], Evalue: 5.20E-121, Aligned region: 416..725
Abhydrolase_6 [PF12697], Evalue: 0.00014, Aligned region: 226..309
PGAP1 [PF07819], Evalue: 0.0027, Aligned region: 244..302
DUF900 [PF05990], Evalue: 0.0061, Aligned region: 37..46
DUF900 [PF05990], Evalue: 0.0061, Aligned region: 214..283
Thioesterase [PF00975], Evalue: 0.0063, Aligned region: 147..188
Thioesterase [PF00975], Evalue: 0.0063, Aligned region: 257..359
Protein Sequence: 746 a.a.     [Download]
>gi|126457559|ref|YP_001074144.1| Type V secretory pathway, adhesin AidA [Burkholderia pseudomallei 1106a]
MNGINDQCFTAARGAGVTMANRPGDRPVPIPRDLPGVVIFIHGVNDPGAAYATVERGLCQGLNERLSRSD
LRPGAYGRRYAAASAAKAEGDSVRYAEVLGDPDMYLYQRAETGGTHSMFLPFYWGYRASDDEIAKISHPG
EVKSRVADSDGNLMTRGQYQDIHGNRLDAHFGKGGGFFANATNNIPQMYSPGFEPDKLERTVMQNALAGN
TIFAGKSPERRYFVLAAARLANLIKTIRTIQPSALALEHGMDPQHETITVMGHSQGTIITLLAQAMLRQQ
GQRCVDCIIMVDTPYSLQFTQDGSQQTGHAKLKTLVDIVNAVTSEPHTIPELAELMIDSAHSCGRAGQNW
SKTQGKRPDKGGKHWITFDERDNRGKVYLYFCPEDTVVGLDKVRGIGTFGVPDEVPADGAAASRGKTMPA
MTVLEPKRFFQRMWTRLERDQDGRGKRSKVAVGTPPARVPVRDPFQRLTPGPDTDGTMLGTLVESGKNMA
LQASFKRNDIRFINGEQLKPAYEPDLYGGEVQKGGQVPGHADVAGLMRPDDVTKNVALGNQYAKFKWKDV
ATTDDPGAGIEPHKQAFNRGRPVDEQSHNWRIVPSRSLGSMLSAAATGGRYQTYVIQREETPDEVRKRMR
TDADQLEANNYHSGVLLSSENHRWVTAMDVAIGQAVTLDDPDWRQLLLLMADWKMTPDVYRNIQKCKNFE
RLDEHTREFVKACVDYYKTGRFPDEKYVPLTMPPLVTSELKVESKT
-
Nucleotide Sequence: 2241 bp     [Download]
>gi|126455463|ref|NC_009078.1|:91141-93381 Burkholderia pseudomallei 1106a chromosome II, complete sequence
ATGAACGGAATCAACGATCAGTGTTTCACCGCCGCCCGCGGGGCGGGCGTGACGATGGCGAATCGGCCCG
GCGACCGGCCCGTGCCGATTCCGCGCGATCTGCCGGGCGTGGTGATCTTCATCCACGGCGTCAACGATCC
CGGGGCGGCTTATGCCACCGTGGAGCGCGGGCTGTGCCAGGGGCTCAATGAGCGCTTGTCGCGAAGCGAT
CTGCGGCCGGGGGCGTATGGCAGGCGGTATGCGGCTGCGTCGGCGGCGAAAGCCGAGGGCGATAGCGTTC
GGTATGCGGAAGTGCTGGGCGATCCGGACATGTATCTGTATCAACGTGCGGAGACCGGCGGTACTCACAG
CATGTTCCTGCCGTTCTACTGGGGCTATCGGGCGTCCGATGACGAGATCGCGAAGATCAGCCATCCGGGC
GAGGTCAAGAGCCGCGTGGCGGACAGCGACGGCAACCTGATGACGCGCGGCCAGTATCAGGACATCCACG
GCAACCGGCTCGACGCCCATTTCGGCAAGGGCGGCGGGTTTTTCGCCAACGCGACGAACAACATCCCGCA
GATGTACAGCCCGGGCTTCGAACCGGACAAGCTCGAGCGCACGGTCATGCAAAACGCGCTGGCCGGCAAT
ACGATCTTCGCCGGCAAGTCGCCCGAGCGCCGTTACTTCGTGCTGGCCGCGGCTCGCCTGGCGAATCTCA
TCAAGACCATTCGGACCATTCAGCCCTCCGCGCTCGCGCTCGAACATGGAATGGACCCTCAGCACGAAAC
GATCACGGTGATGGGGCACAGCCAGGGCACGATCATCACGCTGCTCGCGCAGGCGATGCTCAGGCAGCAA
GGGCAGCGCTGCGTCGATTGCATCATCATGGTCGATACGCCGTACAGCCTGCAGTTCACCCAGGACGGCA
GCCAGCAAACCGGGCACGCGAAGCTCAAGACGCTGGTCGACATCGTCAACGCGGTGACGAGCGAGCCGCA
TACGATTCCGGAGCTGGCCGAACTGATGATCGATTCGGCCCATTCGTGCGGCCGGGCCGGACAGAACTGG
AGCAAGACGCAGGGAAAGCGGCCGGACAAGGGCGGCAAGCACTGGATCACGTTCGACGAGCGCGACAACC
GCGGCAAGGTCTATCTGTACTTTTGCCCGGAAGATACCGTGGTCGGCCTCGACAAGGTGCGGGGGATCGG
CACGTTCGGCGTGCCCGACGAGGTGCCGGCCGATGGCGCGGCGGCCAGCCGGGGCAAAACGATGCCCGCG
ATGACGGTGCTTGAGCCGAAGCGCTTCTTTCAGCGCATGTGGACGCGGCTCGAGCGCGACCAGGACGGCA
GGGGGAAGCGCTCGAAGGTCGCCGTCGGCACGCCGCCCGCGCGCGTGCCGGTTCGCGACCCGTTTCAGCG
ATTGACGCCGGGCCCCGACACGGACGGCACGATGCTTGGCACCTTGGTCGAATCCGGCAAGAACATGGCG
CTGCAGGCATCGTTCAAGCGCAACGACATTCGCTTCATCAACGGCGAGCAACTGAAACCGGCGTACGAGC
CCGATCTGTACGGGGGCGAGGTTCAGAAAGGCGGACAGGTGCCCGGGCACGCCGATGTCGCCGGGTTGAT
GCGTCCGGACGACGTGACGAAAAACGTCGCGCTCGGCAACCAGTACGCGAAGTTCAAATGGAAAGACGTC
GCGACGACGGACGATCCGGGCGCCGGCATCGAGCCGCACAAGCAGGCATTCAATCGCGGCCGTCCGGTCG
ACGAGCAGTCGCATAACTGGCGCATCGTGCCGAGCCGGTCGCTCGGCTCGATGCTGTCGGCGGCCGCCAC
GGGCGGACGGTATCAGACGTACGTGATCCAGCGCGAGGAGACGCCGGACGAGGTTCGCAAGCGCATGCGT
ACCGATGCCGATCAACTGGAAGCGAACAACTATCATTCGGGCGTACTGCTCAGTTCGGAGAACCATCGCT
GGGTCACGGCGATGGATGTGGCGATCGGTCAGGCGGTGACGCTGGATGATCCGGACTGGCGGCAGTTGTT
GCTTTTGATGGCGGATTGGAAGATGACGCCGGACGTGTATCGCAATATCCAGAAATGCAAGAACTTTGAG
CGCTTGGACGAACACACGCGCGAATTCGTGAAAGCGTGTGTCGACTACTACAAGACGGGCCGATTTCCCG
ACGAGAAGTATGTACCTCTCACCATGCCACCGCTCGTGACCAGCGAACTGAAGGTTGAGAGCAAAACATG
A