SecReT6
Effector Protein ID: 126458074
-
SecReT6 ID184
T6SS typeA4b
Gene symbol-
Locus tagBURPS1106A_A1615
StrainBurkholderia pseudomallei 1106a
Repliconchromosome I [GenBank: NC_009078] [Browse all T6SS(s) in this replicon]
Location [Strand]1582879..1585665 [-]
Productputative Rhs element Vgr protein
Effector typeProtein
Homologous effectorBTH_I3225
Descriptiontype VI secretion system Vgr family protein
UniProt IDA3P5N9
KEGG IDbpl:BURPS1106A_A1615
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.00E-57, Aligned region: 47..378
DUF2345 [PF10106], Evalue: 5.90E-42, Aligned region: 614..646
DUF2345 [PF10106], Evalue: 5.90E-42, Aligned region: 700..851
T6SS_Vgr [PF13296], Evalue: 2.60E-39, Aligned region: 563..671
T6SS_Vgr [PF13296], Evalue: 2.60E-39, Aligned region: 740..805
Phage_base_V [PF04717], Evalue: 1.00E-18, Aligned region: 462..546
Protein Sequence: 928 a.a.     [Download]
>gi|126458074|ref|YP_001075649.1| putative Rhs element Vgr protein [Burkholderia pseudomallei 1106a]
MTNLNDTLRNFASGAVDWNKRPVALHFGAAQAALGHLLALQHASVQEGLMTGIHGRLTCVSTRRDLPPGV
LLGIPVSIRLITDRGQPHTVNAIISGVQIGQSDGELCVYQLTVCDALSLMDKRTNSRVFRKRSVIEVLAT
LFNEWQQRSPALARAFEFDLSGLRADRYPPRELTRQVNESDAHFVRRLLRREGITVFAKAGPAKGERPLQ
GDAPVHTLVCCDDPMSLPQAPAGTVRLHPRDGGAAQRDTVTLFALRRQLAPGKAGRPSWDYKKARIDESS
VASSLDQGEAGNDLAKLLTDIAIDIAHAGDSWRDHERLTRARMLAHEFEAERHDGVSSVRDLAVGTWITL
TGDPQWDRQRADKRQFVITSIDHDIWNNLPKGLNERVHALFAASRNLACAPRALPSALANDADTRYENTF
ACVRRGVPLAPAYDPQADLPPAHLLTGTIVGAEGEEVFCDEDGRVRVRVHGLDPADHAHAQGAGTNGNAG
DSAPIRVASSLAGAHFGASFLPRVGMEVLLGCLGGDPDRLVIIGVLGNGAHPPATFSHAGGLPGNRYLSG
IKTKEIRGQRYNQLRLDDTPNQISAQLASEHAHSQLNLGYLTQPRENGHGNDRGEGVELRTDAAAALRAA
QGMLLTTYARTQASGGQLDRDELIRLLGECAELFKALGDYAGQHGGQAADTAGQHAVAAAFKRWAPGTGT
DGADAPSDGAARALMAFGAQAGSVNVTPKTHVTYAGENIDQVAQQHLQLMSGQRLNATAGQGMQLFARGA
GVQAVAGEGPMLLQAQAGTLTANAQKGIKITTNEHEVFVSAPKIRLVAEDGSYLELGGGITLGTNGDIKL
LSASHQWGGPSTAQAAKSGFGNQPTDQRFKLHYPGEDGDLQAAANKRFRITLDDGRVIEGKTDASGLTDL
VKDDAMRIAKIDYLKPKL
-
Nucleotide Sequence: 2787 bp     [Download]
>gi|126455463|ref|NC_009078.1|:c1585665-1582879 Burkholderia pseudomallei 1106a chromosome II, complete sequence
GTGACCAATTTGAACGATACGCTACGCAATTTTGCGTCGGGGGCGGTCGACTGGAATAAACGTCCGGTCG
CGTTGCACTTTGGCGCCGCGCAGGCCGCGCTGGGCCACCTCCTCGCGCTGCAGCACGCCAGTGTTCAGGA
AGGCCTGATGACCGGGATCCACGGCCGATTGACCTGCGTGTCGACCCGCCGCGACCTTCCGCCCGGCGTG
TTGCTCGGCATTCCGGTTTCGATCCGGCTCATTACCGACCGCGGACAGCCGCACACGGTGAACGCGATCA
TCAGCGGCGTCCAGATCGGCCAAAGCGACGGCGAGCTCTGTGTGTACCAGCTGACGGTCTGCGACGCGCT
GTCGCTGATGGACAAGCGCACCAATTCGCGGGTCTTCCGAAAGCGCAGCGTCATCGAGGTGCTCGCCACG
CTGTTCAACGAATGGCAGCAGCGCAGCCCGGCCCTCGCGCGCGCGTTCGAATTCGATCTGTCCGGCTTGC
GCGCCGATCGCTATCCGCCCCGCGAGCTGACCCGGCAGGTCAACGAATCGGATGCGCATTTCGTGCGCCG
TCTGCTGCGCCGCGAAGGGATCACCGTGTTCGCGAAGGCGGGGCCGGCGAAGGGCGAACGGCCGTTGCAG
GGCGATGCGCCCGTGCACACGCTCGTGTGCTGTGACGATCCGATGTCGTTGCCGCAAGCGCCGGCCGGCA
CGGTCCGCTTGCATCCGCGCGACGGCGGCGCCGCGCAGCGCGACACGGTCACGCTGTTCGCGCTGCGTCG
GCAATTGGCGCCCGGCAAGGCCGGCCGCCCGTCGTGGGACTACAAGAAGGCGCGGATCGACGAATCGAGC
GTCGCTTCGAGCCTCGATCAGGGCGAGGCGGGCAACGACCTGGCGAAGCTGCTGACCGACATCGCGATCG
ACATTGCGCACGCGGGCGATTCATGGCGCGATCACGAGCGGCTCACCCGCGCGCGCATGCTCGCGCACGA
GTTCGAAGCCGAGCGCCATGACGGCGTCAGCAGCGTGCGGGATCTCGCCGTGGGCACATGGATCACGCTG
ACGGGCGATCCGCAATGGGACAGGCAACGCGCCGACAAGCGTCAGTTCGTGATCACGTCGATCGATCACG
ACATCTGGAACAACCTGCCGAAGGGGCTCAACGAGCGCGTGCACGCGCTGTTCGCCGCAAGCCGCAATCT
CGCGTGCGCGCCCCGCGCGCTGCCGTCCGCGCTGGCGAACGACGCGGATACCCGCTACGAGAACACGTTC
GCGTGCGTGCGCCGCGGCGTGCCGCTTGCGCCCGCGTACGATCCGCAAGCCGATTTGCCGCCCGCGCATC
TGCTCACGGGCACGATTGTCGGCGCGGAGGGCGAAGAAGTGTTCTGCGACGAAGACGGCCGGGTGCGCGT
GCGGGTGCACGGCCTCGATCCGGCGGATCACGCGCACGCGCAGGGCGCGGGCACCAACGGCAACGCGGGC
GACAGCGCGCCGATCCGCGTGGCGTCGAGCCTTGCCGGCGCCCATTTCGGCGCATCGTTCCTGCCGCGAG
TCGGCATGGAAGTCCTCCTCGGGTGTCTCGGCGGCGATCCGGACCGGCTGGTGATCATCGGCGTGCTCGG
TAACGGCGCGCATCCGCCGGCGACGTTCAGCCACGCGGGCGGGCTGCCGGGCAACCGCTACCTGTCGGGC
ATCAAGACGAAGGAGATTCGTGGGCAACGGTACAACCAGCTGCGTCTCGACGACACGCCGAACCAGATCA
GCGCGCAACTGGCGAGCGAGCACGCGCATTCGCAGCTCAATCTCGGATATCTGACGCAACCGCGCGAGAA
CGGCCACGGGAACGACCGCGGCGAGGGCGTGGAGTTGCGTACCGACGCGGCGGCGGCGCTTCGGGCGGCG
CAAGGCATGCTGCTGACGACCTACGCGCGCACGCAGGCGAGCGGCGGGCAACTGGACCGTGACGAGCTGA
TTCGGTTGCTCGGCGAATGCGCGGAGCTGTTCAAGGCGCTGGGCGACTACGCGGGGCAGCACGGCGGGCA
GGCCGCGGATACGGCCGGCCAGCACGCGGTGGCCGCCGCGTTCAAGCGCTGGGCGCCGGGCACGGGCACG
GACGGCGCCGATGCGCCGTCCGACGGCGCAGCGCGCGCGCTGATGGCGTTCGGCGCGCAGGCCGGTTCGG
TGAACGTCACGCCGAAGACGCATGTGACGTATGCCGGCGAGAACATCGATCAGGTCGCGCAGCAGCACCT
GCAACTGATGAGCGGCCAGCGGCTGAACGCGACGGCCGGGCAGGGCATGCAGCTCTTCGCGCGGGGCGCG
GGGGTGCAGGCCGTGGCGGGCGAAGGGCCGATGCTGCTGCAGGCGCAAGCCGGCACGCTGACGGCGAACG
CGCAGAAGGGCATCAAGATCACGACGAACGAGCACGAGGTGTTCGTGAGTGCGCCGAAGATTCGGCTCGT
TGCCGAGGACGGCAGCTACCTCGAGCTCGGCGGCGGCATCACGCTCGGCACGAACGGCGACATCAAGCTG
CTGTCGGCGTCGCACCAGTGGGGCGGGCCGTCGACCGCGCAGGCGGCGAAGAGCGGGTTCGGCAATCAGC
CGACGGATCAGCGTTTCAAGCTGCACTATCCGGGCGAGGACGGCGATTTGCAGGCGGCGGCGAACAAGCG
GTTCCGGATCACGCTGGACGACGGGCGCGTCATCGAAGGCAAGACCGACGCGAGCGGCCTGACGGATCTG
GTCAAGGACGACGCGATGCGTATCGCGAAGATCGACTATCTGAAGCCGAAGCTCTGA