SecReT6
Effector Protein ID: 134294574
-
SecReT6 ID198
T6SS typeA4b
Gene symbol-
Locus tagBcep1808_0462
StrainBurkholderia vietnamiensis G4
Repliconchromosome I [GenBank: NC_009256] [Browse all T6SS(s) in this replicon]
Location [Strand]497632..498135 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBCAL0343
DescriptionHcp protein
UniProt IDA4JB21
KEGG IDbvi:Bcep1808_0462
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.50E-43, Aligned region: 6..139
Protein Sequence: 167 a.a.     [Download]
>gi|134294574|ref|YP_001118309.1| hypothetical protein Bcep1808_0462 [Burkholderia vietnamiensis G4]
MLHMHMQFGSPAVKGESADKDHQGWIELKSWDHSIVQPRSATASTAGGHTMTRCEHGDMIFTKEIDSSSP
LLYQHASGGTTFDEVTVHFSRADGEGKRVQYLEVKLKYVIISSIAPSVREEGLPIETFSLKYAAVQWKQT
QQKIGGNQGGNTQGAWSLTKNDKTYAV
-
Nucleotide Sequence: 504 bp     [Download]
>gi|134294128|ref|NC_009256.1|:497632-498135 Burkholderia vietnamiensis G4 chromosome 1, complete sequence
ATGTTACATATGCACATGCAGTTTGGTAGTCCGGCGGTGAAGGGCGAGTCCGCCGACAAGGACCATCAGG
GCTGGATCGAACTGAAATCGTGGGATCACTCGATCGTTCAGCCGCGTTCGGCAACGGCATCGACCGCAGG
CGGTCACACGATGACGCGTTGCGAGCACGGCGACATGATCTTCACGAAGGAGATCGATTCGTCGAGCCCG
CTGCTGTATCAGCACGCTTCGGGCGGCACCACGTTCGACGAAGTCACGGTCCATTTCTCGCGCGCGGACG
GCGAAGGCAAGCGCGTGCAGTATCTGGAAGTGAAGCTCAAGTACGTGATCATCTCGAGCATCGCGCCGAG
CGTGCGTGAAGAAGGTCTGCCGATCGAGACGTTCTCGCTCAAGTACGCAGCCGTGCAGTGGAAGCAAACC
CAGCAGAAGATCGGCGGCAACCAGGGCGGCAACACGCAGGGCGCCTGGAGTCTGACGAAGAACGACAAGA
CCTACGCGGTCTAA