SecReT6
Effector Protein ID: 145301290
vgrG
SecReT6 ID199
T6SS typeA1
Gene symbolvgrG
Locus tagASA_P4G080
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconchromosome [GenBank: NC_009349] [Browse all T6SS(s) in this replicon]
Location [Strand]75519..77561 [-]
ProductvgrG protein
Effector typeProtein
Homologous effectorABG57133
Descriptiontype VI secretion system Vgr family protein
UniProt IDA4SU10
KEGG IDasa:ASA_P4G080
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.20E-70, Aligned region: 30..328
Phage_base_V [PF04717], Evalue: 1.60E-23, Aligned region: 372..465
DUF2345 [PF10106], Evalue: 0.00065, Aligned region: 569..615
Protein Sequence: 680 a.a.     [Download]
>gi|145301290|ref|YP_001144130.1| vgrG gene product [Aeromonas salmonicida subsp. salmonicida A449]
MAQSTGLQFTVKVGALADNTFAVASFKLDEGLNRPFNLHLEVASQQPDIDFGAVLDQPCELLVWYNAELQ
RRVCGVVSEFAQGDSGFRRTRYSLQVKPALWRLGLRQNSRIFQAQKPDEILSILLQEHGITDYAFALKNE
HAQREYCVQYRETDLDFVNRLAAEEGLFYFHEFEQGKHRIVFADDAAALTAGPELFFNLGNRSLEQGAYV
RQFHYRESVRPSDVELKDYSFKTPAYGLSHKKQGAELAHQRDTYQHFDYPGRYKQDGSGKAFAQHRLDAL
RNDAVAGSGKSNSAALLPGQFFSLTEHPNRVLNTDWQIVHIRHTGEQPQALEEEGGSGPTVYHNEFGVVK
ASTTWRARIGSPQAPHKPMVDGPQIAIVVGPEGEEIYCDEHGRVKLQFPWDRYSDGLDQSSCWVRVSQGW
AGGQYGMMAIPRIGHEVIVSFLEGDPDQPIVTGRTYHATNRPPYELPANKTRTVLRTETHQGEGFNELRF
EDQAGQEEIYIHGQKDLNAVIQNDAAWHIKHDQHTDIDNERFARIKANDHLTVEGEKRDHIKADYSLTVD
ASLHQKLAQSLLVEAGQEVHIKTGNKIVLEAGSELTLKVGGSFVKVDPSGVTLAGTTIKMNSGGSPGSGS
GWAGQMPGLPGAVKVPPAPPATIPASVIQKSMESMAPLVKPCPFAQGGKA
-
Nucleotide Sequence: 2043 bp     [Download]
>gi|145301211|ref|NC_009349.1|:c77561-75519 Aeromonas salmonicida subsp. salmonicida A449 plasmid 4, complete sequence
ATGGCACAAAGCACAGGATTACAATTTACCGTCAAGGTCGGCGCGTTGGCTGACAACACCTTCGCGGTCG
CGAGCTTCAAGCTGGATGAGGGCTTGAATCGTCCTTTTAACCTCCACCTTGAGGTAGCCAGCCAGCAACC
GGATATAGACTTTGGCGCCGTGCTGGATCAGCCCTGCGAGCTGCTGGTGTGGTACAACGCCGAGTTGCAA
CGCCGGGTTTGTGGGGTCGTGAGCGAGTTTGCCCAAGGGGACAGTGGTTTTCGCCGTACCCGTTACAGCC
TGCAAGTCAAACCGGCCCTGTGGCGATTGGGCCTGCGCCAGAACTCCCGTATCTTCCAGGCACAGAAGCC
TGACGAAATCCTCAGTATCCTGCTGCAAGAGCACGGCATCACCGATTACGCCTTTGCCCTGAAAAACGAG
CACGCCCAGCGGGAATACTGCGTCCAGTACCGCGAAACCGACCTCGATTTCGTTAACCGCTTGGCCGCCG
AAGAGGGACTGTTCTACTTCCACGAGTTTGAGCAAGGCAAACACCGTATTGTCTTTGCCGATGATGCGGC
GGCACTGACTGCTGGCCCCGAACTCTTCTTCAACCTTGGCAACCGATCACTGGAACAAGGGGCTTATGTT
CGCCAGTTCCACTACCGCGAATCAGTACGGCCCTCTGATGTAGAGCTCAAGGACTACAGCTTCAAGACCC
CGGCCTATGGCCTGTCCCACAAGAAACAGGGCGCAGAGCTCGCGCACCAGCGTGATACTTACCAGCATTT
TGACTATCCGGGTCGCTATAAGCAGGATGGTAGCGGCAAAGCCTTCGCCCAACACCGGCTCGATGCCCTG
CGCAATGACGCGGTGGCGGGCAGTGGCAAGTCCAACAGTGCCGCCCTGTTGCCGGGGCAATTCTTCTCGC
TAACGGAACACCCTAACCGCGTCCTCAACACCGACTGGCAAATCGTCCATATCCGCCATACCGGTGAACA
ACCCCAGGCTCTGGAGGAAGAGGGCGGCAGCGGCCCGACCGTCTACCACAACGAATTTGGTGTAGTGAAA
GCGAGCACCACCTGGCGCGCGCGGATTGGCAGCCCACAGGCACCCCACAAGCCCATGGTGGATGGCCCGC
AAATCGCCATCGTGGTGGGCCCCGAGGGTGAAGAGATTTACTGCGACGAGCATGGTCGGGTCAAACTGCA
ATTCCCGTGGGATCGCTACAGTGACGGTCTTGACCAAAGCTCATGCTGGGTACGGGTATCCCAAGGCTGG
GCTGGTGGCCAATATGGCATGATGGCCATCCCCCGTATCGGCCACGAGGTCATCGTCAGCTTTCTGGAAG
GAGACCCCGACCAGCCTATCGTGACGGGGCGCACCTACCACGCCACCAACCGACCACCGTATGAGTTGCC
AGCCAACAAGACCCGCACCGTGCTGCGCACCGAGACTCACCAAGGTGAGGGCTTCAACGAACTGCGTTTC
GAAGACCAGGCTGGGCAGGAAGAGATTTACATCCACGGTCAGAAAGACCTGAACGCGGTCATCCAGAACG
ATGCGGCTTGGCATATCAAGCACGACCAGCATACCGATATCGACAACGAGCGCTTCGCCCGCATCAAGGC
CAACGACCACCTGACGGTCGAGGGGGAGAAGCGCGACCACATCAAGGCGGACTACTCACTCACGGTGGAT
GCCTCCCTGCACCAGAAGCTGGCCCAGTCGCTGCTGGTTGAGGCGGGCCAAGAGGTCCACATCAAGACAG
GTAACAAGATTGTGCTGGAAGCAGGTTCCGAGCTAACCCTCAAGGTCGGTGGTAGCTTTGTGAAAGTTGA
TCCGAGCGGCGTCACCCTGGCCGGTACCACCATCAAGATGAACTCTGGCGGCAGCCCCGGATCTGGCTCT
GGGTGGGCAGGACAAATGCCAGGCCTGCCGGGGGCGGTAAAGGTACCGCCAGCACCACCAGCGACCATCC
CGGCGAGCGTAATCCAAAAGAGTATGGAATCCATGGCCCCGCTGGTGAAGCCCTGCCCCTTTGCTCAGGG
AGGTAAGGCATGA