SecReT6
Effector Protein ID: 145599321
-
SecReT6 ID203
T6SS typeA3
Gene symbol-
Locus tagYPDSF_2045
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]2305709..2306278 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorROD_27741
DescriptionHcp protein
UniProt IDA4TMB2
KEGG IDypp:YPDSF_2045
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.30E-43, Aligned region: 34..164
Protein Sequence: 189 a.a.     [Download]
>gi|145599321|ref|YP_001163397.1| hypothetical protein YPDSF_2045 [Yersinia pestis Pestoides F]
MCLRIHMGSSYTRCFALSDIYKSAREDIMAQDMFIKIDGIEGESLDANHKNEIQVLAWNWDVAQHSNMHS
GSGGGSGKASVSDFCFAHYIDKASPNLLSYCLLGKHIKNVQFVLRKAGGDPLEYLTIKFTDVIITRVDMA
GSLEDETRPREEIRFSFTKMTQDYVMQNAEGHKSGVISANYDVKANMHS
-
Nucleotide Sequence: 570 bp     [Download]
>ref|NC_009381.1|:c2306278-2305709 hypothetical protein YPDSF_2045 [Yersinia pestis Pestoides F]
ATGTGCCTCCGTATTCATATGGGGTCTTCCTACACTCGATGTTTTGCATTGAGTGACATTTATAAAAGTG
CTAGAGAGGATATTATGGCGCAAGATATGTTTATCAAAATTGATGGTATTGAAGGTGAGTCTTTGGATGC
CAATCACAAAAACGAAATCCAGGTATTAGCTTGGAACTGGGATGTTGCTCAACACTCGAATATGCACAGC
GGTTCAGGTGGCGGTTCAGGTAAAGCCTCTGTTTCAGATTTTTGCTTCGCACATTATATCGATAAAGCTA
GCCCGAACTTATTGAGCTATTGCTTGTTGGGTAAGCACATTAAAAATGTTCAGTTCGTACTGCGTAAAGC
TGGTGGCGATCCGCTGGAATATCTGACAATTAAATTTACCGATGTCATCATTACTCGTGTTGATATGGCG
GGTTCTTTGGAAGATGAAACGCGTCCACGTGAAGAAATTCGTTTCTCATTCACTAAGATGACTCAGGACT
ATGTTATGCAGAATGCTGAAGGCCATAAGTCTGGCGTTATTTCTGCTAACTACGATGTTAAAGCTAACAT
GCACAGCTAA