SecReT6
Effector Protein ID: 146301006
-
SecReT6 ID910
T6SS typeC
Gene symbol-
Locus tagFjoh_3262
StrainFlavobacterium johnsoniae UW101
Repliconchromosome [GenBank: NC_009441] [Browse all T6SS(s) in this replicon]
Location [Strand]3902623..3902237 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorFjoh_3262
DescriptionHcp
UniProt IDA5FET8
KEGG IDfjo:Fjoh_3262
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 128 a.a.     [Download]
>gi|146301006|ref|YP_001195597.1| hypothetical protein Fjoh_3262 [Flavobacterium johnsoniae UW101]
MSFLTSLTVAGKDYKVLNVSYDLAQETDASGRPSTVTRGGRIMIEVESTGSTELFEWMTNNFERKDGSVK
FIKRDSNATLKELKFTEAYMVKYKENFDHNSENPLTETFMISARKISMGGGEFDNAWV
-
Nucleotide Sequence: 387 bp     [Download]
>gi|146297766|ref|NC_009441.1|:c3902623-3902237 Flavobacterium johnsoniae UW101 chromosome, complete genome
ATGTCGTTTTTAACATCATTAACAGTAGCAGGAAAAGATTACAAAGTATTAAACGTAAGTTATGATTTAG
CTCAAGAAACAGATGCTTCTGGGCGTCCATCTACGGTAACACGCGGAGGAAGAATCATGATCGAAGTTGA
ATCAACTGGAAGTACTGAATTATTTGAATGGATGACTAACAATTTCGAAAGAAAAGACGGGTCAGTAAAA
TTCATCAAACGTGATTCAAATGCTACTTTAAAAGAGCTAAAGTTTACAGAGGCTTACATGGTTAAGTACA
AAGAAAACTTTGATCATAACAGTGAAAATCCATTAACTGAAACTTTTATGATTTCTGCTCGTAAAATTTC
GATGGGTGGAGGAGAATTTGATAATGCTTGGGTATAA

Reference
(1) Russell AB et al. (2014). A Type VI Secretion-Related Pathway in Bacteroidetes Mediates Interbacterial Antagonism. Cell Host Microbe. 16(2):227-36. [PudMed:25070807] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature