SecReT6
Effector Protein ID: 146301018
-
SecReT6 ID910
T6SS typeC
Gene symbol-
Locus tagFjoh_3274
StrainFlavobacterium johnsoniae UW101
Repliconchromosome [GenBank: NC_009441] [Browse all T6SS(s) in this replicon]
Location [Strand]3912310..3915042 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorFjoh_3274
DescriptionFjoh_3274
UniProt IDA5FET5
KEGG IDfjo:Fjoh_3274
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 910 a.a.     [Download]
>gi|146301018|ref|YP_001195609.1| hypothetical protein Fjoh_3274 [Flavobacterium johnsoniae UW101]
MSDFKIIGNPDPVVGKEEFYSVNTFLPSILPFQNSASSNSFEQPVKWEIYILENGRWRKTKENDKTGKRI
SYTFLQKSLERKGIRILARRGEDVARLNVTTHPAEKPKIESIELLDKNGQKPGKPLSYGQTLKARVHCLH
MEKHKVSVTLWEDDAIGAGHNKANENNLIQTLSGVVANGKADVDFLLRPSFAKIAKQNGPEEGKIHEYYV
TVDFNKDKIASNNVNVNDLEAPVAPFKGKVPVQQQAPAKPKASLPQPTQPKTKAPATGSSSAPKVKAEIT
RVHITNSAKQPIKGTHKEKEIIVWVDSQGLIGKEIRFKLYDEDYLSNDLLVDQKFKITGDIFPITVQLDR
ILRSKGGISGEGAEQELFADVEVIQTSIHSKSEVVDVDAKVFKPDPVDSTNKVAKIGEGDKSSIKGKGEC
YCGKDFEEKDVKKLVKLLKGSEIIWEGAYLGKKHIDCNISDKTFVTLTKSLNSAFKKYSIYSCIQKIHFL
AQVCEETGTFALSEETEGQHDSSKSIYKGRGILQLTGVKKKGEKLYNGEGPYKDYADYIGDPDIVKKPEV
VANNVNYCIDSGAWIWSVNKRMPSDRNSEAVKRWARETAGKSLNELAVFGDKYLELISVLLNGRNKDKGN
MPNGWENRKSMYTKLKTVFFQYHLYHKDDSKPVLPQGIITYNIYSDGRIERNTPKQIESGFEKKYKYVYH
DKKNKEHEICIVDFVTAQNWVVGSKEDGGKGWEKRTAGGKTRYYQKGNGQVELVKVNLPIYHSEGDVLID
VGDNTDREYLNPRAFASMLGALAECGYSDFNFNGSTSLDGTGAPSVTHVNGVSFDFRYLRKDKTGNNLYI
NTDPNSLDVERQEKFIDALIKFGYSQFYSFNIKIKNQNFILKNSTHLADHHHHLHIRREGYKPNFKETKE
-
Nucleotide Sequence: 2733 bp     [Download]
>gi|146297766|ref|NC_009441.1|:c3915042-3912310 Flavobacterium johnsoniae UW101 chromosome, complete genome
ATGTCAGATTTTAAAATAATTGGAAATCCGGATCCTGTTGTAGGTAAGGAAGAATTCTACTCAGTAAATA
CTTTTTTACCGAGTATTCTGCCTTTTCAAAATTCAGCTTCTAGTAATAGTTTTGAACAGCCAGTAAAATG
GGAAATATATATTCTCGAAAATGGAAGATGGCGCAAGACTAAAGAAAATGATAAAACAGGAAAAAGAATC
TCTTACACCTTTCTTCAAAAAAGTTTAGAAAGAAAAGGAATCCGCATTCTGGCAAGAAGAGGAGAAGATG
TGGCACGTCTGAATGTAACGACACATCCCGCCGAAAAACCAAAAATTGAAAGCATAGAACTGCTTGATAA
AAACGGACAAAAACCAGGAAAACCACTTTCATACGGACAGACTTTAAAAGCAAGGGTTCACTGTCTTCAT
ATGGAAAAACACAAAGTATCTGTTACCTTATGGGAAGATGATGCTATTGGTGCCGGACATAACAAAGCAA
ATGAAAATAATCTAATACAAACTCTTTCAGGAGTTGTTGCAAACGGTAAAGCAGATGTTGACTTTTTGCT
GAGACCAAGTTTTGCTAAAATTGCAAAACAAAATGGGCCGGAAGAAGGTAAAATTCACGAATACTATGTT
ACTGTTGATTTTAACAAAGATAAAATTGCAAGTAACAACGTAAACGTAAATGATCTTGAAGCTCCTGTAG
CGCCTTTTAAAGGTAAAGTTCCGGTACAGCAGCAAGCACCTGCTAAACCCAAAGCTTCTCTACCACAGCC
GACACAGCCAAAAACTAAAGCACCAGCCACGGGATCTTCATCAGCGCCAAAAGTTAAAGCAGAAATTACC
AGAGTACATATTACAAACTCTGCTAAACAGCCTATAAAAGGAACTCACAAGGAAAAAGAAATTATCGTTT
GGGTTGACTCACAAGGTTTGATTGGAAAAGAGATCCGTTTTAAATTATATGATGAAGATTATTTAAGTAA
TGATTTATTAGTTGATCAAAAATTTAAGATTACTGGCGATATATTTCCAATTACTGTACAACTAGACAGG
ATATTAAGAAGCAAAGGAGGGATTTCTGGAGAAGGTGCAGAGCAGGAATTGTTTGCTGATGTTGAAGTTA
TACAAACTAGTATACATAGCAAAAGTGAAGTAGTTGATGTAGATGCTAAAGTTTTTAAACCAGATCCTGT
TGATTCAACTAATAAGGTTGCGAAGATTGGAGAAGGGGATAAGAGCAGTATTAAAGGTAAAGGAGAGTGT
TATTGCGGTAAAGATTTTGAAGAAAAAGATGTTAAAAAGTTAGTAAAACTTTTAAAAGGATCAGAAATTA
TCTGGGAAGGAGCTTATTTAGGAAAAAAACATATAGATTGTAATATTAGCGATAAAACGTTTGTTACTCT
GACAAAGTCATTAAATAGTGCTTTTAAAAAATATAGCATATACTCCTGTATTCAGAAAATACATTTTCTT
GCTCAAGTTTGTGAAGAAACAGGAACTTTTGCTTTGTCTGAAGAAACAGAAGGTCAGCATGACTCTAGTA
AAAGCATATACAAAGGTCGAGGAATATTACAACTTACAGGAGTTAAAAAAAAGGGAGAAAAATTATATAA
TGGAGAAGGACCTTATAAGGATTATGCTGATTATATAGGAGATCCAGATATTGTTAAGAAACCAGAAGTT
GTAGCTAATAATGTGAATTATTGTATTGATAGTGGTGCATGGATATGGAGTGTAAATAAGAGAATGCCCT
CAGATAGAAATTCAGAAGCAGTGAAAAGATGGGCAAGAGAAACAGCAGGAAAATCACTCAATGAGTTAGC
GGTTTTTGGTGATAAATATTTAGAATTGATTTCTGTTTTACTTAATGGAAGAAATAAAGATAAAGGAAAT
ATGCCTAATGGATGGGAAAATAGAAAGAGTATGTATACTAAACTAAAAACAGTCTTCTTTCAATATCATC
TTTATCATAAAGATGACTCTAAACCAGTATTGCCACAGGGTATTATTACATATAACATATATTCTGACGG
AAGGATAGAAAGAAATACTCCAAAACAAATCGAGTCTGGTTTTGAAAAGAAATATAAGTATGTTTATCAT
GATAAAAAGAATAAAGAACATGAAATATGTATTGTTGATTTTGTAACTGCTCAAAATTGGGTTGTTGGTT
CAAAAGAAGATGGAGGTAAAGGCTGGGAGAAAAGAACTGCAGGAGGAAAAACGCGTTACTATCAAAAAGG
TAATGGACAGGTTGAGCTAGTAAAAGTAAACCTGCCAATATATCATAGTGAAGGTGATGTATTAATTGAT
GTTGGTGATAACACAGATAGGGAATATTTAAATCCACGTGCTTTTGCATCCATGCTGGGAGCTTTAGCTG
AATGTGGTTATTCGGATTTTAATTTTAATGGCTCTACTTCCCTAGATGGAACAGGAGCACCAAGTGTAAC
CCATGTAAATGGAGTCTCTTTTGACTTTAGATATTTAAGAAAAGATAAGACGGGTAATAACCTATATATT
AATACAGATCCTAATTCTTTGGATGTAGAGAGACAAGAAAAATTTATCGATGCTCTTATAAAATTTGGTT
ACTCTCAGTTCTATAGTTTTAACATTAAAATTAAAAATCAAAATTTTATACTTAAAAATTCAACTCATTT
AGCTGATCATCACCACCATTTGCACATTCGAAGAGAGGGATATAAACCAAATTTTAAAGAAACAAAAGAA
TAG

Reference
(1) Russell AB et al. (2014). A Type VI Secretion-Related Pathway in Bacteroidetes Mediates Interbacterial Antagonism. Cell Host Microbe. 16(2):227-36. [PudMed:25070807] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature