SecReT6
Effector Protein ID: 146307349
-
SecReT6 ID207
T6SS typeA3
Gene symbol-
Locus tagPmen_2324
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]2565959..2566447 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA0085
DescriptionHcp protein
UniProt IDA4XUR6
KEGG IDpmy:Pmen_2324
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-43, Aligned region: 6..136
Protein Sequence: 162 a.a.     [Download]
>gi|146307349|ref|YP_001187814.1| unnamed protein product [Pseudomonas mendocina ymp]
MAVDMFIKIGDLEGESADKTHGKEIDVLAWSWGMSQSGNMHQGGGGGAGKVSIQDISITKWIDKSSPNLM
MACSNGKHFPEAKLTVRKAGGESPVEYLIITLKEVLVSSVSTGGSGGEDRLTENVSLNFAQVLVDYQPQK
ADGAKDGGPVKYGWNIRENVKV
-
Nucleotide Sequence: 489 bp     [Download]
>gi|146305042|ref|NC_009439.1|:2565959-2566447 Pseudomonas mendocina ymp chromosome, complete genome
ATGGCTGTTGATATGTTCATCAAGATCGGCGATCTGGAAGGCGAATCCGCCGACAAGACCCACGGAAAGG
AAATCGACGTACTGGCATGGAGCTGGGGCATGTCGCAGAGCGGCAACATGCACCAGGGCGGTGGTGGCGG
TGCCGGCAAGGTCAGCATTCAGGACATCTCGATCACCAAGTGGATCGACAAGTCCTCACCCAACCTGATG
ATGGCGTGTTCCAACGGCAAGCACTTCCCGGAAGCCAAGCTGACGGTGCGCAAGGCCGGCGGCGAATCGC
CGGTGGAGTACCTGATCATCACCCTCAAGGAAGTCCTGGTGTCCTCCGTCAGCACCGGCGGCAGCGGTGG
CGAGGATCGCCTGACCGAGAACGTCTCGCTCAACTTCGCCCAGGTGCTGGTCGACTACCAGCCGCAGAAA
GCCGATGGCGCCAAGGATGGAGGCCCGGTCAAGTACGGCTGGAACATCCGCGAGAACGTCAAGGTATGA