SecReT6
Effector Protein ID: 146309501
-
SecReT6 ID207
T6SS typeA3
Gene symbol-
Locus tagPmen_4487
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]4919837..4920355 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDA4Y0W8
KEGG IDpmy:Pmen_4487
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.50E-40, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|146309501|ref|YP_001189966.1| unnamed protein product [Pseudomonas mendocina ymp]
MPTPAYLSLEGTKQGLITAGTFTEDSVGNIFQEGHEDQILVQAYNHQVIIPRDPQSGQPTGQRVHKPLMI
TKVFDKSSPLIFNALTSGERLNKCRLEWYRTSSTGTQEHYFTIELEDAVIVDVQSRMPNCQDPNMAHFTH
LEDVYFTYRKIVWTHEVSGTSGSDDWRTPISA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|146305042|ref|NC_009439.1|:4919837-4920355 Pseudomonas mendocina ymp chromosome, complete genome
ATGCCAACACCCGCGTATCTGTCCCTCGAAGGCACCAAACAAGGTCTGATCACCGCTGGCACCTTCACCG
AGGACTCGGTCGGCAACATTTTCCAGGAAGGTCATGAAGACCAGATTCTGGTGCAAGCCTACAACCACCA
GGTCATCATCCCGCGCGACCCGCAGTCCGGCCAACCGACTGGCCAGCGCGTGCACAAGCCGCTGATGATC
ACCAAGGTCTTCGACAAATCCTCGCCGCTGATCTTCAACGCCCTGACCTCCGGCGAGCGTCTGAACAAGT
GCCGTCTGGAGTGGTACCGCACCTCCTCCACCGGTACCCAGGAGCACTACTTCACCATCGAACTGGAAGA
CGCCGTGATCGTCGACGTACAGTCGCGCATGCCGAACTGCCAGGACCCGAACATGGCGCACTTCACCCAC
CTGGAAGACGTCTACTTCACCTACCGCAAGATCGTCTGGACCCACGAAGTCTCCGGCACTTCCGGCTCCG
ACGACTGGCGTACCCCGATCTCCGCCTAA