SecReT6
Effector Protein ID: 147671643
hcp-1
SecReT6 ID208
T6SS typeA1
Gene symbolhcp-1
Locus tagVC0395_0116
StrainVibrio cholerae O395
Repliconchromosome I [GenBank: NC_009456] [Browse all T6SS(s) in this replicon]
Location [Strand]132421..132939 [-]
Producthcp protein
Effector typeProtein
Homologous effectorVCA0017
DescriptionHcp protein
UniProt IDA5F1M6
KEGG IDvcr:VC395_A0014, vco:VC0395_0116
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.20E-37, Aligned region: 6..155
Protein Sequence: 172 a.a.     [Download]
>gi|147671643|ref|YP_001214957.1| hcp protein [Vibrio cholerae O395]
MPTPCYISIEGQTQGLITAGACTADSIGDSFVEGHEDEMLVQQFDHVVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLLYNALSSGEKLKSVELKWYRTSIEGKQENFFTTKLENASIIDIHCEMPHCQDPAKSDFTQ
NVTVSLSYRKITWDHVNAGTSGSDDWRKPIEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|147671401|ref|NC_009456.1|:c132939-132421 Vibrio cholerae O395 chromosome 1, complete sequence
ATGCCAACTCCATGTTATATCTCTATCGAAGGCCAAACTCAGGGTCTTATCACTGCAGGCGCATGTACTG
CTGACTCTATCGGCGATTCATTCGTTGAAGGCCACGAAGATGAGATGCTGGTTCAGCAGTTTGACCACGT
CGTAACCGTACCGACTGACCCACAATCTGGTCAGCCTTCAGGCCAACGTGTGCACAAGCCATTCAAATTC
ACTGTGGCGCTGAACAAAGCGGTTCCTCTGCTGTACAACGCGCTCTCTTCAGGTGAGAAGCTGAAGTCGG
TTGAGCTGAAGTGGTACCGTACTTCTATCGAAGGTAAACAAGAAAACTTCTTTACCACTAAGCTGGAAAA
CGCGTCTATCATCGATATCCACTGTGAAATGCCACACTGCCAAGACCCAGCAAAATCTGACTTTACTCAG
AATGTGACTGTGTCTCTGTCTTACCGCAAAATCACTTGGGACCACGTTAACGCGGGCACCTCAGGCTCTG
ATGACTGGCGTAAGCCAATCGAAGCGTAA