SecReT6
Effector Protein ID: 147672111
-
SecReT6 ID208
T6SS typeA1
Gene symbol-
Locus tagVC0395_0113
StrainVibrio cholerae O395
Repliconchromosome I [GenBank: NC_009456] [Browse all T6SS(s) in this replicon]
Location [Strand]126068..129325 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorVCA0020
DescriptionVasX protein
UniProt IDA5F1M3
KEGG IDvco:VC0395_0113, vcr:VC395_A0017
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1085 a.a.     [Download]
>gi|147672111|ref|YP_001214954.1| hypothetical protein VC0395_0113 [Vibrio cholerae O395]
MSNPNQAAKTGQTNDAQNPASACPFKQPLIGIIPVRYAFDVYDDQGQALHPLPKADRQWKGQFSIKQRSY
TLRQLRDGWLYVYDETAKTLHEYEVVGCKLTKIDWSDDEANKPTHERGSKGESKSCLLYPAQHTLSIGYA
HQRWTWRVCEHMRSNTSSRHAVMRKVSLKQFESNGTHPHAHFAQYLEDYVADIGTPAEQDIFKDTCTPSL
PVEKSEEAVKGTEFKFVADKAVVSSSDYLQDLPEQNCGLFVALNDPLADVSDLFVTFTTQVAKRTKAIGD
ETQQHKMQMAELTRTLGRIRLEEKEIPDFVKQDPIRILELERAITEYCATAKLAEIESHHLASEGHSPSG
NYALMQQQAEQKLAELKTLYRFEPTSAQMRKWRKKDNSFIDEVRWADLDNFLVEHYTELKGLDEQIKQHY
AQFMSAFNQLGLDPLLFGMDNQDEVQQAYLLALTSQFLVVVTQVNHDEKSLEILKKDLSFDSPKNLMALA
STGFSLQANQAINNHIQGFSTAFLSTSNPSDMVAFATAIANWDTFTGDERIQEKAWFKRWIEPAQSSFGA
LQKAVANQAKESWQAVMELLFPYQNQPKGGTPSLLANLRLLLVESLVREEAVLQHNPKYAAELKQFETKL
NAILQEMNDALELKPGNVSPKNHQIATAQSAQRKLGQLLSSELPMMLTLKNQAAMNTFQQSVNEKLSALS
KNVKTSSASVSQKLGGLGGLLFALNLWNTMTVLENIRYKVAQYPSWNPFKNPALGEAIYATGNTIVVAGA
ISAGRAWVTIAEQGLLDRTLKNALNTTKVLGTKDALKTFAKSIALVATVGMIASALETWESWGKFNDSSK
TDLERFGYLLKAGATGAQGIIFYIQFFTLLGSGIGGPSIAAISAGWMLAGFAVIGIVYLIGVILTNVFKR
SELEIWLSKSTWGKESAHWPVGKELTELEHLLHRPSLRLSQVTQRKAAQWMDSGSLQWQLELTLPDYLKG
QTIGLQITRLPAQPAYYQPQREAVTPILINEQQGKWSIEDNQPVYRITLGGSEKDTVGVCVALPLRWGKE
LSLKFYASGTRAGELDLQSAEANDIATRNLVVGKG
-
Nucleotide Sequence: 3258 bp     [Download]
>gi|147671401|ref|NC_009456.1|:c129325-126068 Vibrio cholerae O395 chromosome 1, complete sequence
ATGAGTAATCCCAATCAAGCTGCGAAAACAGGACAGACCAATGATGCGCAAAATCCCGCCAGTGCATGTC
CTTTTAAACAGCCGTTAATAGGGATAATTCCTGTTCGTTACGCCTTTGATGTTTATGATGATCAAGGTCA
AGCATTACATCCTTTACCCAAAGCGGATCGACAGTGGAAAGGTCAATTCTCTATCAAGCAGCGCAGTTAC
ACTTTAAGGCAACTGCGTGATGGCTGGCTCTATGTCTATGATGAAACAGCAAAAACACTGCACGAATATG
AAGTCGTTGGCTGCAAGTTGACCAAAATTGATTGGTCTGATGATGAGGCAAACAAACCCACTCACGAGCG
CGGTTCGAAAGGTGAAAGCAAAAGCTGTTTACTCTATCCCGCCCAGCACACGCTCTCTATCGGTTATGCG
CATCAACGATGGACGTGGCGAGTGTGTGAGCATATGCGCTCCAATACCAGCAGCCGTCATGCTGTGATGC
GTAAAGTGAGCCTTAAACAGTTTGAGTCCAATGGTACTCACCCTCATGCACATTTTGCTCAGTATCTTGA
AGACTATGTGGCGGACATCGGGACGCCAGCTGAGCAGGATATTTTTAAAGATACCTGTACCCCTTCATTA
CCGGTAGAGAAAAGTGAAGAAGCGGTGAAAGGTACGGAATTCAAATTCGTTGCCGACAAAGCGGTGGTAA
GCAGCAGTGATTATTTGCAAGATTTGCCGGAGCAAAACTGCGGTTTATTTGTGGCGCTGAATGACCCTTT
AGCGGATGTGTCAGATTTATTTGTTACTTTTACTACCCAAGTGGCAAAGCGAACTAAAGCGATTGGTGAT
GAAACGCAACAGCATAAAATGCAGATGGCAGAGCTGACACGCACATTAGGCCGAATTCGTCTTGAAGAAA
AAGAAATTCCCGATTTTGTAAAACAAGATCCGATCCGTATTTTAGAGCTAGAAAGAGCCATTACTGAATA
TTGTGCTACGGCAAAATTGGCCGAAATCGAATCTCATCATTTAGCCAGTGAAGGGCATTCCCCATCGGGA
AACTATGCCTTGATGCAGCAGCAAGCGGAGCAGAAACTGGCGGAATTGAAAACACTCTATCGCTTTGAAC
CCACCAGTGCTCAGATGCGCAAGTGGCGCAAAAAAGACAACAGCTTTATTGATGAAGTGCGTTGGGCGGA
TTTAGATAACTTTTTGGTGGAGCATTACACCGAGCTCAAAGGATTGGATGAACAGATTAAACAACACTAT
GCGCAGTTTATGTCTGCCTTCAACCAGCTCGGCCTTGACCCGCTTCTGTTTGGTATGGATAACCAAGATG
AGGTTCAGCAAGCGTATTTGTTAGCATTAACTAGCCAATTTTTAGTGGTGGTTACGCAAGTCAATCATGA
TGAAAAATCGCTTGAGATCCTAAAAAAAGATCTCAGTTTTGATTCACCGAAAAACCTCATGGCCCTCGCG
TCAACAGGCTTTTCCCTGCAGGCAAATCAAGCCATTAACAACCATATCCAAGGGTTTAGCACCGCTTTTC
TCTCTACAAGTAATCCTAGTGATATGGTGGCGTTTGCGACCGCAATCGCTAACTGGGATACGTTCACGGG
GGATGAACGTATTCAGGAGAAAGCATGGTTTAAGAGATGGATTGAACCCGCTCAATCGAGTTTTGGTGCA
CTGCAAAAAGCGGTCGCCAATCAAGCCAAAGAGAGTTGGCAAGCGGTGATGGAGTTGCTGTTTCCTTATC
AGAATCAGCCCAAAGGAGGGACGCCCAGTTTGTTGGCTAACCTTCGTTTACTGTTGGTGGAAAGCCTAGT
TCGAGAAGAGGCGGTGCTGCAACATAACCCCAAGTATGCGGCTGAGCTTAAGCAATTTGAGACTAAGCTG
AATGCCATTTTGCAAGAGATGAATGATGCTCTGGAACTCAAACCCGGTAATGTGAGCCCGAAAAACCATC
AAATTGCGACCGCGCAATCCGCACAACGTAAGCTAGGGCAATTACTCAGTAGTGAGCTGCCGATGATGCT
GACGCTCAAAAACCAAGCTGCGATGAACACTTTTCAGCAGTCGGTAAATGAGAAACTGAGCGCGCTATCG
AAAAACGTCAAAACCAGTAGCGCGTCGGTGAGTCAGAAACTGGGTGGATTAGGGGGCTTGCTGTTTGCGT
TGAACCTATGGAATACCATGACGGTTTTGGAGAATATCCGCTATAAGGTCGCACAATACCCCAGTTGGAA
TCCTTTTAAGAACCCGGCGTTGGGCGAAGCCATTTATGCCACTGGCAACACTATTGTAGTCGCCGGTGCC
ATTAGTGCTGGGCGAGCTTGGGTGACGATTGCTGAGCAAGGGTTGTTAGATCGTACACTGAAAAACGCCT
TAAATACCACGAAAGTTTTGGGCACAAAAGATGCCCTAAAAACCTTTGCTAAATCGATCGCCTTGGTGGC
TACCGTGGGCATGATTGCCAGCGCATTAGAAACATGGGAAAGCTGGGGTAAGTTTAATGACAGCAGTAAA
ACCGATCTTGAACGCTTCGGTTATTTGTTAAAAGCTGGAGCAACGGGAGCACAGGGAATTATTTTTTATA
TTCAGTTTTTCACACTCTTAGGTAGTGGAATTGGTGGACCCTCCATAGCTGCGATTTCTGCAGGTTGGAT
GCTCGCCGGTTTTGCTGTGATTGGTATTGTCTATTTGATCGGGGTGATTTTGACCAATGTGTTTAAACGC
TCAGAGTTAGAAATTTGGTTATCAAAATCGACGTGGGGGAAAGAGAGTGCTCATTGGCCAGTGGGCAAAG
AATTGACCGAGTTAGAGCACCTTCTCCATCGTCCGAGTCTTCGGTTGAGTCAAGTTACGCAACGTAAAGC
AGCGCAATGGATGGATTCAGGTTCTTTACAATGGCAGTTGGAACTCACGTTACCCGATTATCTTAAGGGG
CAGACGATAGGCTTACAAATCACCCGTTTGCCAGCGCAGCCGGCATATTATCAACCGCAAAGGGAGGCGG
TAACACCAATACTCATCAATGAACAACAGGGCAAATGGAGTATTGAAGATAATCAGCCAGTGTATCGTAT
TACACTGGGTGGCAGTGAGAAGGATACTGTCGGAGTTTGCGTTGCACTGCCCCTGCGTTGGGGCAAGGAG
CTGAGCCTCAAATTCTATGCCAGTGGAACTCGCGCGGGGGAATTGGATTTACAATCTGCAGAGGCGAATG
ATATTGCCACAAGAAATCTCGTTGTAGGAAAAGGTTAA