SecReT6
Effector Protein ID: 147673444
vgrG-1
SecReT6 ID208
T6SS typeA1
Gene symbolvgrG-1
Locus tagVC0395_A1026
StrainVibrio cholerae O395
Repliconchromosome I [GenBank: NC_009457] [Browse all T6SS(s) in this replicon]
Location [Strand]1068747..1072034 [+]
ProductvgrG protein
Effector typeProtein
Homologous effectorVC1416
Descriptiontype VI secretion system Vgr family protein
UniProt IDA5F8C0
KEGG IDvco:VC0395_A1026, vcr:VC395_1535
PDB ID4E1C, 4E1F, 4DTD, 4DTH, 4DTL, 4DTF, 4E1D
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.70E-64, Aligned region: 42..335
Phage_base_V [PF04717], Evalue: 5.50E-24, Aligned region: 208..226
Phage_base_V [PF04717], Evalue: 5.50E-24, Aligned region: 374..467
DUF2345 [PF10106], Evalue: 0.0062, Aligned region: 498..599
DUF2345 [PF10106], Evalue: 0.0062, Aligned region: 843..867
Protein Sequence: 1095 a.a.     [Download]
>gi|147673444|ref|YP_001216972.1| vgrG protein [Vibrio cholerae O395]
MATLAYSIEVEGLEDETLVVRGFHGQESLSNSVFLGQACYGFRYEVQLASRVSNLTAEQMVDKRAELKLY
RNSQLVQRVHGIVRAFSQGDIGHHHTFYQLTLVPALERLSLRHNSRIFQKQTVPEILSILLQEMGINDYA
FALKRDGVQREFCVQYRESDIDFLHRLAAEEGLVYSFVHEAGKHTLYFSDASDSLSKLPEPIPYNALVGG
AIDTPYIHGLTYRTQAEVSEVQLKDYSFKKPAYSFLQTVQGTELDYQQTRYQHFDAPGRYKDDVNGAAFS
QIRLDYLRRHAHTATGQSNEPLLRAGYKFDLQEHLDPAMNRDWVVVSINHQGEQPQALQEDGGSGATTYS
NQFSLIPGHLHWRAEPQPKPQVDGPMIATVVGPEGEEIFCDEHGRVKIHFPWDRYSNGNEQSSCWVRVSQ
GWAGSQYGFIAIPRIGHEVIVEFLNGDPDQPIITGRTYHATNTPPYTLPEHKTKTVLRTETHQGEGFNEL
SFEDQAGKEQIYLHAQKDFDGLIENDQFTQIKHNQHLTVEWESREAVTGEQVLSIEGSLHVKTGKVRVNE
AGTEIHVKAGQKVVIEAGSEITVKAGGSFVKVDPAGVHLSGALVNLNSGGSAGSGSGFGGAMPALPGGLE
PAVALAPPQTISYQALLQAEQANVPAVKVCPLAAQEATPAVNSITPPPPPPIAPPMAPPQPIMNPQPTAN
AQPNLGRSTKATPDFPTHFPKSSIGIENELAGLVVAMPANSAQKFGYVKSAQGDALFMLTKDMNQGSYQR
PPSLQDGKNYQNWQTHTVELVSYPCEMDDKAAVETRKQAMLWLATHFTTHIDQSNHQPLAPIQSEDGRFV
IEITNAKHVIAAGNGISAESQGQTITMTPSGQQATVGVAAKGFGTSATPELRLLESAPWYQKSLKSQFAS
LTSAENLDDKELAANVFAYLTSIYLKTAELAKKFGIYINEWDPMSEQITPNANGLTDPKVKNAWEILPRT
KPSKIVEILSKSDAKAVMKHIKPQLQSRYSESLSKNVFQYFQDGGEVAGHGINNATVGDKHSPELAILFE
FRTVPNELQSYLPKTESTTKSEVKLLDQFDPMKRKTVIQQVESLV
-
Nucleotide Sequence: 3288 bp     [Download]
>gi|147673035|ref|NC_009457.1|:1068747-1072034 Vibrio cholerae O395 chromosome 2, complete sequence
ATGGCGACATTAGCGTACAGCATTGAGGTGGAAGGGCTGGAAGATGAGACTCTGGTGGTCAGAGGCTTCC
ACGGGCAGGAGTCACTCTCTAATAGTGTTTTTTTAGGGCAAGCCTGTTACGGGTTTCGCTACGAAGTGCA
ACTGGCGAGTCGGGTATCAAACCTCACCGCCGAGCAGATGGTGGATAAGCGTGCCGAGCTCAAGCTTTAC
CGCAACTCACAGTTGGTGCAGCGCGTGCACGGCATTGTGCGTGCTTTCAGCCAAGGCGATATCGGCCATC
ACCACACCTTCTACCAACTCACTTTAGTCCCTGCCTTAGAGCGCTTATCCCTGCGTCATAACAGCCGCAT
TTTCCAAAAGCAGACTGTCCCTGAGATTCTCTCTATCTTGCTGCAAGAGATGGGCATCAACGATTACGCT
TTTGCGCTCAAACGTGATGGCGTGCAGCGTGAGTTTTGTGTGCAGTACCGCGAAAGCGATATCGACTTTC
TGCACCGCCTCGCCGCTGAAGAAGGTTTGGTGTACAGCTTTGTCCATGAAGCGGGCAAACATACCCTCTA
TTTCAGTGATGCCAGTGATAGCCTAAGCAAACTGCCGGAGCCTATCCCATACAACGCTTTAGTCGGTGGC
GCGATAGATACCCCGTATATCCACGGCTTAACCTATCGCACCCAAGCAGAAGTGAGCGAAGTTCAGCTCA
AAGACTACAGCTTCAAAAAGCCAGCCTACTCCTTTTTGCAAACCGTGCAGGGTACTGAGCTGGATTATCA
GCAAACGCGCTACCAACATTTTGATGCGCCGGGGCGCTACAAAGACGATGTGAACGGCGCCGCCTTTAGC
CAAATCCGTTTAGACTACCTGCGCCGCCATGCCCATACCGCAACAGGGCAGAGCAACGAGCCGCTGCTGC
GTGCCGGCTATAAGTTTGACCTGCAAGAGCACCTTGACCCCGCGATGAACCGCGATTGGGTGGTAGTGTC
GATTAACCACCAAGGTGAGCAGCCGCAAGCGCTACAAGAAGACGGTGGCAGCGGCGCTACTACTTACAGC
AATCAGTTCAGCTTAATTCCGGGGCATCTTCACTGGCGCGCCGAGCCACAACCCAAACCGCAAGTCGATG
GTCCAATGATTGCCACGGTCGTCGGTCCTGAAGGCGAAGAAATCTTCTGTGATGAACATGGGCGGGTGAA
AATCCATTTCCCGTGGGACCGTTACTCGAACGGTAACGAGCAAAGCTCCTGTTGGGTACGGGTGTCGCAA
GGTTGGGCGGGCAGTCAGTATGGCTTTATCGCTATTCCGCGCATCGGCCATGAAGTGATTGTAGAGTTTT
TAAACGGTGACCCAGACCAACCGATTATCACTGGCCGCACTTATCATGCGACCAACACGCCGCCATACAC
CTTGCCTGAGCACAAAACCAAAACCGTGCTGCGCACCGAGACGCACCAAGGGGAGGGCTTTAACGAGCTC
AGTTTTGAAGACCAAGCGGGCAAAGAGCAAATCTACCTGCATGCGCAGAAAGATTTTGATGGTTTGATTG
AAAACGACCAATTTACCCAGATTAAGCACAACCAACACCTGACGGTGGAGTGGGAAAGTCGAGAAGCGGT
AACGGGCGAGCAAGTGCTGAGTATTGAAGGCTCGCTGCATGTGAAAACAGGCAAAGTTCGGGTCAATGAA
GCGGGTACAGAGATCCATGTAAAAGCGGGACAGAAAGTGGTGATTGAAGCGGGCTCCGAGATTACCGTTA
AAGCGGGCGGCAGCTTTGTGAAAGTCGATCCGGCTGGGGTGCATCTGTCCGGTGCTTTGGTCAATCTCAA
CTCTGGCGGCAGCGCTGGTAGTGGTAGCGGCTTTGGCGGTGCAATGCCCGCCTTACCGGGCGGCTTAGAA
CCCGCCGTGGCACTGGCTCCACCGCAAACCATCTCTTACCAAGCGTTGCTACAGGCCGAGCAAGCGAATG
TTCCTGCGGTGAAGGTGTGTCCTTTAGCCGCTCAAGAAGCAACGCCTGCGGTGAATAGTATCACGCCGCC
TCCACCACCACCGATTGCTCCGCCAATGGCCCCACCACAACCAATAATGAATCCACAGCCAACCGCTAAC
GCGCAGCCTAATCTTGGAAGATCCACTAAGGCAACGCCGGATTTTCCAACACATTTCCCGAAGTCATCCA
TTGGCATTGAGAATGAGTTAGCTGGTCTAGTGGTGGCTATGCCAGCCAACTCGGCACAGAAATTTGGCTA
CGTGAAAAGTGCACAAGGTGATGCGCTGTTTATGTTAACGAAAGACATGAACCAAGGTTCGTATCAGCGG
CCACCTTCATTACAAGATGGAAAAAATTATCAGAATTGGCAGACGCATACAGTAGAGTTGGTGAGCTACC
CTTGTGAAATGGACGATAAAGCTGCCGTTGAAACACGCAAACAAGCCATGTTGTGGTTAGCAACCCACTT
TACTACGCATATCGACCAGTCCAATCATCAACCATTAGCTCCTATTCAAAGTGAAGACGGACGCTTTGTT
ATCGAAATCACTAATGCGAAGCATGTGATTGCTGCGGGCAATGGGATTTCTGCAGAATCTCAAGGTCAAA
CAATCACGATGACACCAAGTGGACAACAAGCCACAGTGGGTGTTGCTGCTAAAGGTTTCGGGACGAGTGC
AACGCCAGAATTAAGGTTACTTGAATCGGCACCTTGGTATCAGAAATCACTCAAGAGCCAATTTGCATCT
CTAACGAGCGCAGAAAACTTGGATGATAAAGAGTTAGCTGCAAACGTATTTGCTTATCTGACGTCTATTT
ATTTAAAAACAGCAGAGCTAGCGAAGAAGTTTGGTATTTACATCAATGAATGGGACCCCATGTCGGAGCA
AATTACTCCAAATGCGAATGGATTAACGGATCCAAAAGTAAAAAATGCATGGGAAATATTGCCACGTACA
AAACCAAGCAAAATAGTAGAAATACTCAGTAAGAGTGATGCCAAAGCGGTTATGAAACATATCAAGCCTC
AATTGCAGTCTCGCTATTCTGAGAGTTTGTCGAAAAATGTATTTCAATATTTCCAAGATGGTGGTGAAGT
AGCCGGACACGGTATTAATAATGCGACGGTCGGTGATAAACATAGTCCGGAATTGGCGATTTTGTTTGAG
TTCAGAACTGTTCCGAATGAACTGCAAAGTTATTTGCCTAAAACAGAATCGACAACTAAGTCAGAAGTGA
AGTTACTCGATCAGTTTGATCCTATGAAGCGTAAAACAGTAATTCAACAAGTAGAATCGCTTGTGTAA