SecReT6
Effector Protein ID: 147673623
-
SecReT6 ID208
T6SS typeA1
Gene symbol-
Locus tagVC0395_A1028
StrainVibrio cholerae O395
Repliconchromosome I [GenBank: NC_009457] [Browse all T6SS(s) in this replicon]
Location [Strand]1073032..1074957 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorVC1418
DescriptionTseL
UniProt IDA5F8A4
KEGG IDvco:VC0395_A1028, vcr:VC395_1537
PDB IDNA
Domain hit(s) vs Pfam Lipase_3 [PF01764], Evalue: 1.20E-22, Aligned region: 319..434
CarboxypepD_reg [PF13620], Evalue: 0.0047, Aligned region: 23..88
Protein Sequence: 641 a.a.     [Download]
>gi|147673623|ref|YP_001216974.1| hypothetical protein VC0395_A1028 [Vibrio cholerae O395]
MDSFNYCVQCNPEENWLELEFRSENDEPIDGLLVTITNQSAPSNTYTQTTSSGKVLFGKIAAGEWRASVS
QASLLTEVEKYASRKEGQESPVKKRAAAELDAADKDTKQYRFTTIGDFWDEAPKDEFLQKQHKGIDVNAS
AEKAGFRLSHNQTYVFEIKALRSYMPVIIDTDEFNLVNSYTFALLSKLAYATNDFNRDDGKTIDNQGAIS
TVISQLKRKERPTYSGDLQAKWLLEEIPYSKALSAQYYAEDDVGSEGYIIFNDELAIIGVRGTEPYFQSK
KPPVDNTKFKIIKAASGMAAVIADKIESATDSPGMKDLIITDLDAAQIAPEEFGGTYVHRGFYQYTMALL
SLMEKDLGLHKIKKFYCCGHSLGGAGALLISALIKDSYHPPVLRLYTYGMPRVGTRSFVERYQNILHYRH
VNNHDLVPQIPTVWMNTDVSEGFHVLDVFKSRVDLMRKMLTDDDDDNYQHHGHLSQLLTYNSNNQVLLTP
KQTQVTMLDLANLATNDSVAMVDGLSDASIVEHGMEQHIPNLFEQLTALSDESLMVHYQRAISALEQEIA
TLQQSYLTVKQAWIESIGNGTPTMNIGRLMSEMHSINKLIENRNKIRGELRQIVSDPQRMPATKFLISQQ
TLPDEIKVQIR
-
Nucleotide Sequence: 1926 bp     [Download]
>gi|147673035|ref|NC_009457.1|:1073032-1074957 Vibrio cholerae O395 chromosome 2, complete sequence
ATGGATTCATTTAATTATTGCGTGCAGTGTAACCCTGAGGAAAACTGGTTAGAGCTAGAGTTTCGGAGTG
AAAATGATGAACCGATAGATGGTTTGCTAGTTACGATTACGAACCAAAGTGCCCCCTCTAACACATACAC
GCAAACCACAAGTTCGGGTAAGGTGTTGTTTGGCAAGATTGCGGCTGGGGAATGGCGTGCTTCTGTAAGC
CAAGCTTCTCTGTTAACTGAAGTCGAAAAATATGCCAGCCGTAAAGAGGGACAAGAGTCGCCAGTGAAAA
AACGAGCTGCGGCAGAACTTGACGCCGCAGATAAAGATACGAAGCAGTACCGCTTTACCACTATTGGTGA
TTTCTGGGATGAAGCACCAAAAGATGAGTTTTTACAAAAGCAGCATAAAGGGATAGATGTCAATGCTTCT
GCTGAGAAAGCAGGGTTTAGACTCAGTCATAACCAGACCTATGTTTTTGAAATCAAAGCACTACGTAGCT
ATATGCCAGTGATTATTGATACCGATGAATTTAACTTGGTGAATAGTTATACCTTTGCGTTGTTGTCGAA
ATTAGCTTATGCGACTAACGATTTTAATAGGGATGATGGTAAGACAATAGATAATCAGGGAGCAATTAGC
ACGGTTATTTCTCAATTGAAGCGTAAAGAAAGACCGACTTATTCTGGAGATTTACAAGCAAAGTGGTTAT
TAGAGGAAATTCCATATAGCAAAGCGTTAAGTGCCCAATATTATGCTGAGGATGATGTCGGTAGTGAAGG
TTACATCATCTTTAACGATGAATTGGCGATTATAGGTGTGAGAGGTACAGAGCCTTATTTTCAGAGTAAG
AAACCACCTGTTGATAACACTAAATTTAAAATTATAAAAGCGGCTTCAGGTATGGCGGCTGTGATTGCGG
ATAAGATAGAAAGTGCTACCGATTCACCAGGAATGAAAGACCTTATTATAACAGACCTTGATGCTGCGCA
AATCGCCCCCGAAGAGTTTGGTGGAACATATGTTCATCGGGGGTTTTACCAATATACGATGGCTTTGTTA
TCTTTGATGGAGAAAGATCTAGGGCTACATAAAATAAAAAAATTCTATTGTTGTGGCCATAGCTTAGGGG
GCGCTGGTGCATTACTTATAAGTGCATTGATTAAAGATAGCTATCATCCTCCAGTATTGCGTTTATATAC
ATATGGAATGCCACGAGTGGGAACTCGCAGTTTTGTAGAGCGCTATCAAAATATTTTGCATTACCGTCAT
GTTAATAATCACGATTTGGTGCCACAGATACCAACAGTATGGATGAACACAGATGTATCTGAAGGATTCC
ATGTACTTGATGTATTTAAAAGCCGTGTTGATCTGATGAGAAAAATGCTCACTGATGATGATGATGACAA
TTATCAACACCATGGTCATTTGTCTCAGTTACTAACTTATAATTCAAATAACCAAGTCTTACTGACACCC
AAACAAACTCAAGTCACTATGCTAGACCTAGCAAATTTAGCCACTAATGATTCTGTTGCTATGGTAGATG
GTTTATCAGATGCCTCAATAGTAGAGCATGGAATGGAGCAGCATATACCCAATTTATTTGAGCAGTTAAC
AGCACTAAGTGATGAAAGTTTAATGGTGCATTATCAACGAGCGATTTCAGCCTTAGAGCAGGAAATTGCT
ACGTTGCAACAAAGTTATCTTACAGTTAAACAAGCTTGGATTGAATCTATAGGAAATGGCACGCCGACTA
TGAATATCGGACGTTTGATGAGTGAAATGCATTCTATAAATAAATTAATAGAGAACCGTAATAAAATTAG
AGGTGAGCTAAGGCAGATAGTCTCTGATCCTCAGCGTATGCCTGCAACTAAATTTTTAATTTCACAGCAA
ACCTTACCAGATGAAATCAAGGTGCAAATAAGATGA