SecReT6
Effector Protein ID: 148547339
SecReT6 ID211
T6SS typeA1
Gene symbol-
Locus tagPput_2118
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]2398843..2399358 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorECA2866
DescriptionHcp protein
UniProt IDA5W297
KEGG IDppf:Pput_2118
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-38, Aligned region: 6..155
Protein Sequence: 171 a.a.     [Download]
>gi|148547339|ref|YP_001267441.1| unnamed protein product [Pseudomonas putida F1]
MPTPAYIKIVGQTQGNITAGAFTADSVGNVFQQGHEDQILVQEIKHEVTTPTDPQSGQPSGQRVHKPFIF
TSSLNKATPLMYQALATGEMLPTVEVSWYRTSEEGKQEHFFTTTLEDATIVSINTVLPHALDKDNENYTQ
LIEVSLAYRKITWAHDVANTEGSDDWRNPIA
-
Nucleotide Sequence: 516 bp     [Download]
>gi|148545259|ref|NC_009512.1|:c2399358-2398843 Pseudomonas putida F1 chromosome, complete genome
ATGCCAACACCCGCTTACATCAAGATCGTAGGCCAGACCCAAGGCAACATCACCGCTGGCGCCTTCACCG
CTGACTCCGTCGGCAACGTGTTCCAACAAGGCCATGAAGATCAAATTCTGGTTCAGGAAATCAAGCATGA
GGTGACTACGCCCACTGACCCCCAGAGCGGTCAACCGAGTGGCCAGCGCGTGCATAAGCCTTTCATATTC
ACCAGTTCACTGAACAAAGCTACCCCCCTGATGTATCAGGCACTTGCCACCGGCGAAATGCTGCCAACGG
TCGAAGTCAGCTGGTATCGCACCTCGGAGGAAGGCAAGCAAGAGCACTTTTTCACGACCACGCTAGAAGA
CGCCACCATCGTCAGCATCAATACCGTGCTTCCCCATGCACTCGACAAAGACAATGAAAACTACACACAA
CTGATTGAAGTATCCCTGGCGTATCGAAAGATCACGTGGGCTCACGATGTAGCCAATACCGAAGGTTCTG
ACGACTGGCGCAATCCGATCGCCTGA