SecReT6
Effector Protein ID: 148547850
SecReT6 ID212
T6SS typeA4b
Gene symbol-
Locus tagPput_2634
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]3009756..3010274 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPsyr_4965
DescriptionHcp protein
UniProt IDA5W3Q8
KEGG IDppf:Pput_2634
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.00E-41, Aligned region: 6..146
Protein Sequence: 172 a.a.     [Download]
>gi|148547850|ref|YP_001267952.1| unnamed protein product [Pseudomonas putida F1]
MAFDAYIQIDGIPGEVLDEKHKDWIEVLGYEYGATQATSATASSSGGASSERVALSDFKIRKAVDKASAK
LFEHCCTGKHIAKLKLNVNRAGGDKVTYLTIDMEEVVVSSVKFVAGGNQNGEDKAVSDLPVEEISFNFAR
IKTTYTQQNRTDGQAGGNIVGGWDRTANKVFA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|148545259|ref|NC_009512.1|:3009756-3010274 Pseudomonas putida F1 chromosome, complete genome
ATGGCATTTGACGCGTATATCCAAATCGACGGCATCCCAGGTGAAGTACTGGATGAAAAACACAAGGACT
GGATCGAAGTGCTGGGCTACGAGTACGGCGCCACACAGGCTACGTCGGCAACCGCCAGCTCTTCGGGCGG
TGCGTCCTCCGAGCGCGTTGCCCTGAGCGACTTCAAGATCCGCAAGGCAGTCGACAAGGCATCGGCCAAA
CTGTTCGAACACTGCTGCACCGGCAAGCACATCGCCAAGCTGAAGCTGAACGTGAACCGCGCCGGTGGTG
ACAAGGTCACCTACCTGACCATCGACATGGAAGAAGTGGTGGTCTCTTCGGTCAAGTTTGTCGCCGGTGG
CAATCAGAATGGTGAAGACAAGGCGGTCAGCGACCTGCCCGTTGAAGAAATCAGCTTCAACTTTGCCCGC
ATCAAGACCACCTACACCCAGCAGAACCGTACCGACGGCCAGGCCGGCGGCAACATCGTGGGTGGCTGGG
ACCGCACCGCGAACAAAGTGTTTGCCTAA