SecReT6
Effector Protein ID: 152989635
-
SecReT6 ID219
T6SS typeA1
Gene symbol-
Locus tagPSPA7_1247
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]1259341..1259859 [+]
Productsecreted protein Hcp
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDA6V0P7
KEGG IDpap:PSPA7_1247
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.60E-41, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|152989635|ref|YP_001346632.1| secreted protein Hcp [Pseudomonas aeruginosa PA7]
MATPAYMSITGTKQGLITAGAFTEDSVGNTYQEGHEDQVMVQGFNHEVIIPRDPQSGQPTGQRVHKPVVI
TKVFDKASPLLLAALTSGERLTKVEIQWFRTSAAGTQEHYYTTVLEDAIIVDIKDYMHNCQDPGNAHFTH
LEDVHFTYRKITWTHEVSGTSGSDDWRSPVAG
-
Nucleotide Sequence: 519 bp     [Download]
>gi|152983466|ref|NC_009656.1|:1259341-1259859 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGGCAACACCCGCCTATATGTCCATCACCGGCACCAAGCAGGGCCTGATCACTGCCGGCGCCTTCACCG
AGGACTCGGTCGGCAACACCTACCAGGAGGGCCATGAGGACCAGGTGATGGTCCAGGGCTTCAACCACGA
GGTGATCATCCCTCGTGACCCGCAGTCCGGCCAGCCGACCGGCCAGCGCGTGCACAAGCCGGTGGTCATC
ACCAAGGTCTTCGACAAGGCCTCGCCGCTGCTGCTCGCCGCGCTGACCTCGGGCGAGCGCCTGACCAAGG
TCGAGATCCAGTGGTTCCGCACCTCCGCCGCCGGCACCCAGGAACACTACTACACCACCGTCCTGGAAGA
CGCGATCATCGTCGACATCAAGGACTACATGCACAACTGCCAGGACCCGGGCAACGCCCATTTCACCCAC
CTGGAGGACGTGCATTTCACCTACCGCAAGATCACCTGGACCCACGAAGTCTCCGGCACCTCCGGTTCCG
ACGATTGGCGCTCGCCGGTCGCCGGCTGA